KEGG   Rattus norvegicus (rat): 497867
Entry
497867            CDS       T01003                                 

Gene name
Nudt16l1
Definition
(RefSeq) nudix hydrolase 16 like 1
  KO
K16867  NUDT16-like protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    497867 (Nudt16l1)
SSDB
Other DBs
NCBI-GeneID: 497867
NCBI-ProteinID: NP_001094252
RGD: 1561451
Ensembl: ENSRNOG00000003224
UniProt: B0BNG7
Position
10q12
AA seq 211 aa
MSTTTVPELKQISREEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLL
GFPGGFVDRRFWSLEDGLNRVLGLGLGGLRLTEADYLSSHLTEGPHRVVAHLYARQLTLE
QLHAVEISAVHSRDHGLEVLGLVRVPLYTQKDRVGGFPNFLSNAFVSTAKYQLLFALKVL
NMMPSEKLAEALASATEKQKKALEKLLPASS
NT seq 636 nt   +upstreamnt  +downstreamnt
atgtcgaccacgacggttccggagctgaagcagatcagtcgggaggaagcaatgcgcttg
gggcccggctggagccattcatgccacgccatgctgtacgctgccaaccccgggcaactt
ttcggccgtatccccatgcgtttctcagtactgatgcagatgcgcttcgatgggctgctg
ggctttcccgggggtttcgtggaccgccgcttctggtcactggaggatggcttgaaccgg
gtcctgggtctgggcctgggcggcctacgccttactgaagctgactacctgagttcacac
ctgactgagggtccacaccgtgtggtggcacacctgtacgcacggcagctgacgctggaa
cagctgcatgctgtggagatcagcgctgtgcactcgcgggaccacggtttggaggtcctg
ggccttgtacgtgtcccactgtacacacagaaggatcgagtaggaggcttccctaacttt
ctgagcaacgccttcgtcagcactgccaaatatcagctcctatttgcccttaaggtactc
aacatgatgccctcggaaaagctggccgaggccttggcctcagccacggagaagcagaag
aaggccctagagaagctgctcccggcctcatcctga

DBGET integrated database retrieval system