KEGG   Rattus norvegicus (rat): 497895
Entry
497895            CDS       T01003                                 

Gene name
Mrnip, RGD1564036
Definition
(RefSeq) MRN complex interacting protein
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: MRNIP
Other DBs
NCBI-GeneID: 497895
NCBI-ProteinID: NP_001102500
RGD: 1564036
Ensembl: ENSRNOG00000003068
UniProt: B2RYM4
Position
10q22
AA seq 343 aa
MAPAQQSRVLRCCSCHIFQAHQVKKSLKWTCKACGEKQSFVRAYGEGSGADCRRHVQKLN
LLQGQASELSLRSVEEAVNASEEENAGPQQAKDGSQQALSEPLESRWLKYLDQDCEGQEL
DRGRPALKTQLSASAKWPNLPCSPARPRKRKWDQSTGQPAHSPRVQGVDSGEDNFQHQDS
TGLSGTEQQGISPALSTTNHIRELGFPRWKLPSPVTQVNAPSSKWARFLLSPENSPQVDG
KPTSPLQEGTRRSGLAQIEQGTLETKTPGEGHFIRDPATIRPPLTIHTTTPQPDKPDRKT
PEQPWATGTPQADGGLLAQGTQKAPSMQLHNLFTTGEDFEDDL
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggcgccggctcagcagtctcgggttctacggtgctgcagctgccacatctttcaggca
catcaggtgaagaagagtctcaagtggacatgcaaggcttgtggagagaagcagtctttc
gtgcgggcttatggcgaaggctctggtgctgactgtagacgccatgtccaaaagctaaat
ctgcttcaaggacaagcgtcagagctgtcactcaggtctgtggaggaagctgtaaatgcc
agtgaagaggaaaatgcaggccctcagcaggctaaggatggaagtcagcaggcattgtct
gagcccctcgagtcccgttggctgaagtatctggaccaggactgtgagggccaggagctg
gacagaggaagaccagctcttaagacacagctctcagccagtgctaagtggccaaatctg
ccctgcagtccagcccgacccaggaagaggaaatgggatcagagcacagggcagcctgca
cacagcccgcgtgtccagggtgtggacagtggtgaggacaactttcaacaccaggactcc
actggcctgtctgggacagagcagcaaggcattagccctgccctcagtaccacaaaccac
atcagggagctcggttttcctaggtggaaactaccaagtcctgtcacgcaagttaatgcc
ccatcttctaaatgggcacggtttctcctatcgcctgagaacagtccacaagtggatggg
aaaccaacaagtcctttgcaggagggcaccaggcgatctggcctagcacaaattgagcaa
gggactcttgagaccaagactccaggagaaggccacttcatcagagaccctgccaccatc
cggccgcctctaaccattcacactaccactccacagccagacaagcctgacaggaagacc
ccagagcagccatgggccacggggactcctcaagcagatggtgggcttttggctcaaggg
acacagaaggctccatccatgcaactgcacaacctctttacaaccggagaggactttgag
gatgacctgtag

DBGET integrated database retrieval system