KEGG   Rattus norvegicus (rat): 497900
Entry
497900            CDS       T01003                                 

Gene name
Rmnd5b
Definition
(RefSeq) required for meiotic nuclear division 5 homolog B
  KO
K23333  E3 ubiquitin-protein transferase RMND5 [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    497900 (Rmnd5b)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     497900 (Rmnd5b)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   CTLH complex
    497900 (Rmnd5b)
SSDB
Motif
Pfam: CLTH zf-RING_UBOX Rtf2 zf-RING_2 Sec15
Other DBs
NCBI-GeneID: 497900
NCBI-ProteinID: NP_001017473
RGD: 1559511
Ensembl: ENSRNOG00000047396
UniProt: Q566Q9
Position
10q21
AA seq 393 aa
MEQCACVERELDKVLHKFLTYGQHCEQSLEELLHYVGQLRAELASAALQGTPLSATLSLV
MSQCCRKIKDTVQKLASDHKDIHSSVSRVGKAIDRNFDSEICGVVSDAVWDSREKQQQIL
QMAIVEHLYQQGMLSVAEELCQESTLNVDLDFKQPFLELNRILEALHEQDLGPALEWAVS
HRQRLLELNSSLEFKLHRLHFIRLLAGGPEKQLEALSYARHFQPFARLHQREIQVMMGSL
VYLRLGLEKSPYCHLLDNSHWAEICETFTRDACSLLGLSVESPLSVSFASGCVALPVLMN
IKAVIEQRQCTGVWSHKDELPIEIELGMKCWYHSVFACPILRQQTSDSNPPIKLICGHVI
SRDALNKLINGGKLKCPYCPMEQNPADGKRIIF
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggagcagtgcgcatgtgtggagagggagctcgacaaggtcctgcacaagttcctgacc
tatgggcaacattgtgagcagagcctggaggagctgctgcactacgtgggccagttgaga
gctgaactggccagtgcagctctccaggggacccctctctcagccacgctgtccctagta
atgtcccagtgctgtcggaagatcaaagacacagtccagaagctggcttccgaccataag
gacattcacagcagcgtctcccgagtgggcaaagccattgaccggaactttgactctgag
atctgcggcgtggtctcagatgctgtgtgggactcccgtgagaagcagcagcagatcctg
cagatggccattgtcgagcacctgtaccagcagggcatgctcagcgtagctgaggagctg
tgccaggaatcaacattgaatgtggacctggacttcaagcagcccttcttggagttgaat
cggatcttggaggctctgcatgagcaagacctaggacctgcactggaatgggccgtttcc
cacaggcagcgcctgctggagctcaacagctcactggagttcaagctgcaccggctgcac
tttatccgcctcctagctggtggcccggagaagcagctggaggccctcagctatgcccga
cacttccagccttttgctcggctacaccagagagagatccaggtgatgatgggcagtctg
gtgtacctgcggctgggcttggagaagtcaccctactgccacctcttagacaacagccac
tgggcagagatctgtgagacctttactcgggatgcatgctccctcctggggctttcagtg
gagtccccactcagtgtcagctttgcttctggctgtgtggcactgccagtgctgatgaac
attaaagctgtgatcgaacagaggcagtgcactggagtgtggagtcacaaggatgagttg
ccgattgagattgagctgggcatgaagtgctggtatcactctgtgtttgcgtgccctatc
ctgcgacagcagacctcagattccaacccccctatcaagctcatctgtggccacgtcatc
tccagagatgcactcaacaagctcatcaatggaggaaagctaaagtgtccctattgtccc
atggagcagaacccagcagatgggaaacgtatcatattctga

DBGET integrated database retrieval system