KEGG   Rattus norvegicus (rat): 497902Help
Entry
497902            CDS       T01003                                 

Gene name
Uqcrq, Qpc
Definition
(RefSeq) ubiquinol-cytochrome c reductase, complex III subunit VII
  KO
K00418  ubiquinol-cytochrome c reductase subunit 8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease (NAFLD)
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05016  Huntington disease
Module
rno_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    497902 (Uqcrq)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    497902 (Uqcrq)
  09159 Environmental adaptation
   04714 Thermogenesis
    497902 (Uqcrq)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    497902 (Uqcrq)
   05012 Parkinson disease
    497902 (Uqcrq)
   05016 Huntington disease
    497902 (Uqcrq)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    497902 (Uqcrq)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UcrQ Cyt_b-c1_8
Motif
Other DBs
NCBI-GeneID: 497902
NCBI-ProteinID: NP_001020305
RGD: 1562350
Ensembl: ENSRNOG00000048174
UniProt: Q7TQ16
Position
10q22
AA seq 82 aa AA seqDB search
MGREFGNLTRIRHVISYSLSPFEQRAFPHYFSKGIPNVLRRTRERILRVAPPFVLFYLIY
TWGNQEFAQSKRKNPAKYENDK
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atgggccgcgagtttgggaacctgacgcggatacggcatgtgatctcctacagcttgtcg
ccctttgagcagcgcgccttcccgcactatttcagcaaaggcatccccaacgtgctgcgc
cgcactcgcgagcgcatcctgcgcgtggcgccgccatttgtactgttctatctgatctac
acatggggcaaccaggagtttgcgcagtccaaacggaagaatccagctaagtacgagaat
gacaagtga

DBGET integrated database retrieval system