KEGG   Rattus norvegicus (rat): 497918Help
Entry
497918            CDS       T01003                                 

Gene name
Smcr8, RGD1564621
Definition
(RefSeq) Smith-Magenis syndrome chromosome region, candidate 8
  KO
K23611  guanine nucleotide exchange protein SMCR8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    497918 (Smcr8)
Membrane trafficking [BR:rno04131]
 Autophagy
  Other autophagy associated proteins
   Rab associated proteins
    497918 (Smcr8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Folliculin
Motif
Other DBs
NCBI-GeneID: 497918
NCBI-ProteinID: NP_001178848
RGD: 1564621
Ensembl: ENSRNOG00000005165
UniProt: D3ZJR6
Position
10q22
AA seq 935 aa AA seqDB search
MISAPDVVAFTKEDEYEEEPYNEPALPEEYSVPLFPYASQGANPWSKLSGAKFSRDFILI
SEFSEQVGPQPLLTIPNDTKVFGTFDLNYFSLRIMSVDYQASFVGHPPGSAYPKLNFVED
SKVVLGDSKEGAFAYVHHLTLYDLEARGFVRPFCMAYISADQHKIMQQFQELSAEFSKAS
ECLKTGNRKAFAGELEKKLKDLDYTRTVLHTETEIQKKANDKGFYSSQAIEKANELANVE
KSIIEHQDLLRQIRSYPRQKMKKPDLHPGDTEHTQDQADQVCPTSNPEESANADLYTCRP
AYTPKLIKAKSTKCFDKKLKTLEELCDTEYFTETLAQLSHIEHMFRGDLCYLLTSQIDRA
LRKQQPITNFLFEDFVEVDDRMEKQENVPSQPSHGRLPSKPVEECPIPKVLISVGSYKSS
VESVLIKMEQELGDEEYKEVEATESSSFDPQENLDYMGMDMKGSISSGESIEVLGTEKSA
SVLSKSDSQASLTVPLSPHVVRSKAVSHRTISEDSIEVLSTCPSEALIPDDFKASYPSAI
NEEEAYADNEGAIHFQASASSPELDETQEGNLENIPSQIDSSCCIGKESEGQLVPLPTPA
YTLSDEDGVVSIPPQRYIQKDQGLHMDFGMENTDPSPRDNSCEMFPAYDLDPSCLLASRD
ISKMSLDNYSDSTSYMGSVASTSSDRIPSAPPAGLSSERHKKRAGQNALKFIRQYPFAHP
AIYSLLSGRTLVVLGEDETIVRKLVTALSIFVPNYGCYAKPVKHWISSPLHIMDFQKWKL
IGLQRVASPANVGTLHTLSRYSRYTSILDLDSKTLRCPLYRGTLVPRLADHRTQIKRGST
YYLHVQSMLTQLCSKAFLYTFCHHLHLPAHSEETQEAVASRQTSFLKLNLGLVNEDIRVV
QYLAELLKLHYMQESPGTTHPLLRFDYVPSFLYKI
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcgcccctgatgtggtggcctttaccaaggaagacgaatacgaggaagaacct
tacaatgaacccgctttgcctgaagaatactcagttcctctctttccttatgccagccag
ggcgctaacccctggtctaaactgtctggggccaagttctccagggactttatccttatt
tcagagttctctgagcaggtgggaccacagcccttgctaaccatccccaatgacaccaaa
gtttttggcacttttgatctcaattacttctccttgcggatcatgtcagtggattatcag
gcctctttcgtagggcatcctcctggttctgcctaccccaagttgaactttgtggaggac
tctaaagtggtacttggagactctaaggaaggggcatttgcatatgtgcaccaccttacc
ttgtatgacctggaggccaggggcttcgtgcggcccttttgtatggcttatatctctgca
gaccagcataaaatcatgcagcaattccaagagctctcagccgaattttccaaagcatct
gagtgcttgaagacgggtaacaggaaggcattcgctggggaacttgaaaaaaagctgaaa
gacttggattacacgaggacagtgctacacacagaaaccgagatccagaagaaagccaat
gacaagggtttttattcttctcaggcaattgagaaagccaatgaactggccaatgtggag
aagtccatcattgaacatcaagatttgctgaggcagatccgctcataccctcgtcagaag
atgaagaagcctgatttgcatccaggtgatacagagcatacccaggatcaggctgaccag
gtatgccctacctctaatcctgaggagtcagctaatgcagacctttatacctgcaggccg
gcttacacccccaaactcatcaaagcaaagtccaccaagtgttttgacaagaagttgaag
accttggaggaactctgtgacactgagtatttcactgagaccctggcccagcttagccac
attgaacacatgttcagaggggacctgtgctacctcctgaccagtcagattgacagagca
cttcgaaaacaacagcccataacaaatttcctctttgaagattttgtagaggttgatgac
aggatggagaagcaagagaatgtgccctctcaacccagtcacggcaggctgccttccaag
cctgtagaagaatgccccattcctaaagtgttaattagtgttggctcttacaagtccagt
gtggagtctgtattgatcaagatggagcaggaacttggagacgaagaatacaaggaagta
gaggcaacagagtcaagcagttttgacccccaagaaaacctggactacatgggtatggat
atgaaagggagcatcagtagtggggaaagcattgaggttctgggcactgagaagtcagct
tctgtgttgtcgaaatctgacagccaggctagcctcaccgtgccattgagcccccatgta
gtccgtagcaaagcggtcagccacaggacaatcagtgaggacagcattgaagtcttaagc
acctgcccttctgaggccctcattcctgatgactttaaggccagctacccaagtgccatt
aatgaagaagaagcctatgcagacaatgagggggccatccatttccaggcaagtgccagc
tcaccagaactagatgagactcaggagggcaacttagaaaatatcccatcccaaatagac
tccagctgctgtattggaaaggagagtgaaggtcagttggtgcctctccccaccccagct
tacaccctttctgatgaggatggtgtggtgagcattcccccacagcgctacatacagaag
gaccaggggctccacatggacttcgggatggagaacactgacccttctccccgagacaac
agttgtgaaatgttcccagcttatgatctggatccaagctgccttctggctagccgagat
attagtaagatgagcctggataactactcggatagcactagctacatgggcagtgtggcc
tctaccagctcggacagaatcccctctgctcctcctgctggcctatcctctgagaggcac
aaaaagagagctggccagaatgccttaaaattcatccgccagtacccttttgcccaccca
gccatctactccctgctcagtgggaggacacttgtggtcctgggcgaagatgaaaccata
gtcaggaagctggtaactgcactgtccatcttcgttcccaactatggctgctatgccaag
cccgtgaagcactggatttcctcccctttgcatattatggattttcagaagtggaagctt
attggcctacaaagagtggcctctcctgccaatgtgggtacccttcataccctgagccgt
tacagccgctatacaagcatcctggacctggacagcaagactctacgttgtcccctgtac
aggggtacactggtaccccgcctggctgaccaccgcactcagatcaagcggggcagcaca
tactaccttcatgtccagagcatgctcacccagctctgctccaaggcattcctctatacc
ttttgccaccacttgcatttgcctgctcacagtgaggagacacaagaagcagtggccagc
agacaaaccagcttcctaaagctaaacctgggactagtgaatgaggacatcagagtggta
cagtacctggccgagctgttgaaattgcactatatgcaggagtcacctgggaccacccac
ccactgctcaggtttgactatgtccccagctttttatacaaaatctaa

DBGET integrated database retrieval system