KEGG   Rattus norvegicus (rat): 497929
Entry
497929            CDS       T01003                                 

Gene name
Pirt
Definition
(RefSeq) phosphoinositide-interacting protein
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: PIRT Neurensin TMEM100 DUF872 Phage_holin_3_6 p53-inducible11 DUF418 DUF2663 KASH ATP19 TMEM174 CrgA
Other DBs
NCBI-GeneID: 497929
NCBI-ProteinID: NP_001102502
RGD: 1565284
Ensembl: ENSRNOG00000037852
UniProt: D4A4M4
Position
10
AA seq 137 aa
MEVLPKALEVDERSPESKDLLPSQTASSLCISSRSESVWTTTPRSNWEIYHKPIIIMSVG
AAILLFGVAITCVAYILDESQAQKVVQVLRMIGPAFLSLGLMMLVCGLVWVPIIKKKQKQ
RQKSNFFQSLKFFLLNR
NT seq 414 nt   +upstreamnt  +downstreamnt
atggaggtgctccccaaggccctggaggtagacgagaggtctccagagtccaaggacctg
ctgcccagccagacagccagctccctgtgcatcagctccagaagtgagtctgtctggacc
accactcccagaagcaactgggagatctaccacaagcccatcatcatcatgtccgtgggt
gctgccattctactctttggtgtggccatcacctgcgttgcctacatcctggacgaatcg
caagcgcaaaaggttgtgcaagtcctcaggatgatagggcctgccttcctgtccttggga
ctcatgatgctggtgtgcggactggtgtgggtccccataatcaaaaagaagcagaagcaa
aggcagaagtccaacttcttccaaagcctcaagttcttcctcctgaaccgctga

DBGET integrated database retrieval system