KEGG   Rattus norvegicus (rat): 497933
Entry
497933            CDS       T01003                                 

Gene name
Slc25a35
Definition
(RefSeq) solute carrier family 25, member 35
  KO
K15117  solute carrier family 25, member 34/35
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    497933 (Slc25a35)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   497933 (Slc25a35)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 497933
NCBI-ProteinID: NP_001102503
RGD: 1598229
Ensembl: ENSRNOG00000004668
UniProt: B0BNI6
Position
10q24
AA seq 300 aa
MDFLMSGVAACGACVFTNPLEVVKTRMQLQGELQAPGTYQRHYRNVFHAFFTIGKVDGLA
ALQKGLGPALLYQFLMNGIRLGTYGLAESGGYLRTKEGTHSPVRSAAAGALAGVMGAYLG
SPIYMVKTHLQAQAASEIAVGHQYKHQGMFQALTEIGQKHGLVGLWRGAVGGLPRVVIGS
STQLCTFSSTKDLLSQWEIFPPQSWKVALAAAMVSGVAVVLAMTPFDVASTRLYNQPTDT
RGKGLMYRGILDALLQTARTEGLFGMYKGIGASYFRLGPHTILSLFFWDQLRSFYSTYAK
NT seq 903 nt   +upstreamnt  +downstreamnt
atggacttcttgatgagtggtgtggcagcctgcggggcctgtgtgttcaccaatcccctg
gaggttgtgaagaccagaatgcaattgcagggagaactgcaggctccaggcacctaccag
cgccactatcgaaacgtcttccacgccttcttcaccattggcaaggtggatggcctagct
gccctgcagaaggggctgggccctgcgctcttgtaccagttcctgatgaatggcatccga
ctgggcacctacgggctggcagagtctgggggttacctgcgcactaaagaaggcacgcac
agtcctgtccgcagcgccgcagctggggcccttgctggggtcatgggagcttatctggga
agcccaatctacatggtgaagacacacctacaggcacaggcagcctctgaaattgctgta
gggcaccagtataagcatcagggcatgtttcaggcactaaccgagattggccagaaacat
ggtctagtggggttgtggcgtggggccgtgggcggcctgcccagagttgtcatcggctcc
tccacccagctgtgcaccttctcatccaccaaggacctcttgagccagtgggagatcttt
cctccccagagctggaaggtggctctggcagctgccatggtgagtggagtggcagtagtc
ctggccatgacaccctttgatgtggccagcacaaggctttataaccaacccactgatact
cgaggcaagggcctcatgtaccgggggatcttggacgctctgctgcagacagctcggaca
gagggcctttttggcatgtacaagggtataggtgcttcctattttcgcctcggcccccac
actatcctctccctcttcttctgggatcagctgcgttccttttacagcacatatgctaaa
tag

DBGET integrated database retrieval system