KEGG   Rattus norvegicus (rat): 497935Help
Entry
497935            CDS       T01003                                 

Gene name
RGD1563441
Definition
(RefSeq) similar to RIKEN cDNA A030009H04
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4632 zf-RING_UBOX zf-RING_5 zf-C3HC4 zf-RING_2 FANCL_C zf-C3HC4_3 zf-C3HC4_4
Motif
Other DBs
NCBI-GeneID: 497935
NCBI-ProteinID: NP_001119764
RGD: 1563441
Ensembl: ENSRNOG00000021540
UniProt: B2BKZ7
Position
10q24
AA seq 190 aa AA seqDB search
MQLLMRVPSLPELGELDCNICFRPYNLGARAPRRLPGTARARCGHTLCTACLRELAARGD
GSRTAARVVRLRRVVTCPFCRAPSPLPRGGITEIALDPDLWSRLEEEAQAECEGDPMGSP
AKESGEDGEDDDGEQESEMGAGPSSAGWRALRRILDRVLAPARRLRRPLPSNVLYCPEVK
DIAHMTRCTL
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgcagctcctgatgagagtgccctctcttcccgagctgggtgagctggactgcaacatc
tgcttccgaccctacaacctcggggcccgcgctccccgccgcctgcctggcacggcgcgc
gcccgctgcggccacacgttgtgcaccgcttgcctgcgcgagctggcagcgcggggagac
ggcagccgcacggccgcgcgtgtggtgcgcctgcgccgtgttgtcacgtgcccgttctgc
cgcgcgccttccccgctcccgcgcggcggcatcacggagatcgcgctagatcctgacttg
tggtcacggctggaggaagaagcccaggctgagtgtgaaggagacccgatggggagcccg
gccaaagaaagcggagaggatggagaggacgacgacggggaacaggagagcgagatgggg
gcgggaccttcaagtgccggttggcgcgcgcttcgccgaattttggacagggtcctggcg
cccgcgcgccgcttgcggcgtccgttgcctagcaatgtgctctactgtccagaggtcaag
gacattgcccacatgacgcgttgtacgctgtga

DBGET integrated database retrieval system