KEGG   Rattus norvegicus (rat): 497941
Entry
497941            CDS       T01003                                 

Gene name
Gps2
Definition
(RefSeq) G protein pathway suppressor 2
  KO
K15307  G protein pathway suppressor 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    497941 (Gps2)
SSDB
Motif
Pfam: G_path_suppress MAT1 Golgin_A5
Other DBs
NCBI-GeneID: 497941
NCBI-ProteinID: NP_001017477
RGD: 1562746
Ensembl: ENSRNOG00000016360
UniProt: Q5XII2
Position
10q24
AA seq 327 aa
MPALLERPKLSNAMARALHRHIMMERERKRQEEEEVDKMMEQKMKEEQERRKKKEMEERM
SLEETKEQILKLQQKLSALQEEKHQLFLQLKKVLHEEEKRRRKEQSDLTTLTSAAYQQSL
TVHTGTHLLSMQGSPGGHNRPGTLMAADRAKQMFGPQVLTTRHYVGSAAAFAGTPEHGQF
QGSPGGAYGTAQPPPHYGPTQPAYSPSQQLRAPSAFPAVQYLSQPQPQPYAVHGHFQPTQ
TGFLQPGSALSLQKQMEHANQQTSFSDSSSLRPMHPQALHPAPGLLASPQLPVQIQAAGK
SGFATTSQPGPRLPFIQHSQNPRFYHK
NT seq 984 nt   +upstreamnt  +downstreamnt
atgcccgcacttctggagcgccccaagctttccaacgccatggccagggctctgcaccgg
cacatcatgatggagcgggagcgcaaacggcaggaggaggaagaggtggacaagatgatg
gaacagaagatgaaagaagaacaggagagaagaaagaaaaaggaaatggaagagagaatg
tcactagaagagaccaaggaacaaattctgaaactgcagcagaagctttcagctctacag
gaagagaaacaccagcttttcttgcagctcaagaaagttttgcatgaggaagaaaaacgg
aggcgaaaggaacagagtgacttaaccactctgacatcagctgcataccagcagagcctg
acggttcatacaggaactcacctcctcagcatgcaggggagtcctggaggacacaaccgc
ccaggtactctgatggcagctgacagagccaagcagatgtttggaccacaagtgcttacg
acccggcactacgtgggatcagcagctgcttttgcaggaaccccagaacatggacaattc
caaggcagtccagggggcgcttatgggactgcccagcccccacctcattatgggccaaca
caaccagcctatagtcctagccagcagctgagagctccgtcagcatttcctgcggtgcag
tacctatctcagccacagccacaaccctatgcagtgcatggccactttcagcccactcag
acagggttcctccagcccggtagtgccctctctttgcaaaaacagatggagcatgccaac
cagcagactagcttctctgactcatcttctctgcggcccatgcatccccaagctctgcat
ccagcccctggactcctggcttcccctcagctccctgtacagatacaagcagccgggaag
tcaggctttgccaccaccagccaaccgggccctcgactccctttcatccaacacagccag
aacccacgattctatcacaagtaa

DBGET integrated database retrieval system