KEGG   Rattus norvegicus (rat): 497979
Entry
497979            CDS       T01003                                 

Gene name
Tmem100
Definition
(RefSeq) transmembrane protein 100
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: TMEM100 PIRT SpoIIM Claudin_2 Neurensin Saf_2TM DUF4131
Other DBs
NCBI-GeneID: 497979
NCBI-ProteinID: NP_001017479
RGD: 1560541
Ensembl: ENSRNOG00000002434
UniProt: Q569C0
Position
10q26
AA seq 134 aa
MTEEPTKENLGGPKSPTPVTMEKSPKSEVVVTTVPLVSEVQLTAATGGAELSCYRCIIPF
AVVVFITGIVVTAVAYSFNSHGSVISILGLVLLSSGLFLLASSALCWKVRQRNKKVKRRE
SQTALVVNQRSLFA
NT seq 405 nt   +upstreamnt  +downstreamnt
atgactgaagaacccacaaaagagaacctgggaggcccgaagtctcccacacctgtgaca
atggagaaaagccccaagagtgaagttgtggtcaccacggtccccttggtcagtgaggtt
cagctgacggccgccaccgggggtgccgaactctcttgctaccgctgcatcatccccttt
gccgtggtggtcttcatcaccgggatcgtggtcaccgctgtagcttacagcttcaattcc
catggttccgtcatctccatcttaggcctggtccttctgtcctctggactgtttttacta
gcctccagcgcgttgtgctggaaggtgagacaaaggaacaaaaaagtcaagagacgcgag
agtcagacggctctggtggtaaatcagagaagtttgtttgcttaa

DBGET integrated database retrieval system