KEGG   Rattus norvegicus (rat): 497983Help
Entry
497983            CDS       T01003                                 

Gene name
Fam117a, RGD1561062
Definition
(RefSeq) family with sequence similarity 117, member A
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: FAM117
Motif
Other DBs
NCBI-GeneID: 497983
NCBI-ProteinID: NP_001102509
RGD: 1561062
Ensembl: ENSRNOG00000004417
UniProt: B6ID09
Position
10q26
AA seq 314 aa AA seqDB search
MHKRSASWGSTDHRKEITKLRQQLQRTKLSRSGKEKERSSPVQGDHAVLGAVRVSLPSLP
AGSPVLRLSPCLHRSLEGLNQELEEVFVKEQGEEELLRILEVPDGHRAPAPPQNSNCDHP
LLLEPGNLTSSPSMPLVSPQPPGQASREHHQSATEELASIHGNKASSAGHPAFLEDDSPS
PVLAFAASPRPNHSYVFKREPPEGCERVRVFEEATSPGPDLAFLTSCPDKNKVHFNPTGS
AFCPVSLIKPLFPSMGFIFRNCPSSPGSPLPPASPRAPPRKDPEASKASSLPFEPWQRTP
PSEESVLFQSSLVV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagcgatcagcatcatggggtagcacagaccaccgaaaagagatcaccaagttg
aggcaacagctgcagaggacaaagctgagccgcagtgggaaggagaaggagcggagctcc
cctgtccaaggggaccatgctgtactgggagcagtgagggtatcccttcctagcctcccc
gcaggatcccccgtcctgagactcagcccttgtctgcacagaagcctagaagggctcaac
caggagctggaagaggtgtttgtgaaggagcaaggtgaagaggagctgctgaggatactt
gaggttcctgatggacatcgtgccccggctcctccacagaatagcaactgtgaccacccg
ctcctcctggagccaggcaacctgaccagctctccctccatgccactggtatccccccag
cctcctggccaggccagccgcgagcaccaccagagtgccacagaggagctggcatctatc
cacggtaacaaagcctcttctgcaggccacccagccttcctagaagacgacagtccttct
ccagtccttgcctttgctgcttcccctcggcccaatcacagctatgtcttcaaacgagag
cccccagaaggctgtgagagagtgcgtgtgtttgaggaggccacgtccccaggtcctgac
ttggccttcttgacttcctgtcctgacaagaacaaagtccatttcaacccgactggctct
gccttctgccctgtcagcttgatcaagcccctctttcccagtatgggcttcattttccgt
aactgcccctccagccctggctctcctctccctcctgccagccccagggcaccacctcgg
aaggatccagaagcttccaaggcctcctcgctgccatttgagccatggcagcgcacgcca
ccatcagaagagtctgtgcttttccagagctccttggtagtctga

DBGET integrated database retrieval system