KEGG   Rattus norvegicus (rat): 497988
Entry
497988            CDS       T01003                                 

Gene name
Hoxb4, RGD1560113
Definition
(RefSeq) homeo box B4
  KO
K09304  homeobox protein HoxA/B/C/D4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    497988 (Hoxb4)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Antp
    497988 (Hoxb4)
SSDB
Motif
Pfam: Homeodomain DUF2209
Other DBs
NCBI-GeneID: 497988
NCBI-ProteinID: NP_001094257
RGD: 1560113
Ensembl: ENSRNOG00000008191
UniProt: B1WBS2
Position
10q26
AA seq 250 aa
MAMSSFLINSNYVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESGFQPEAAFGRRAPC
TVQRYAACRDPGPPPPPPPPPPPPPPGLSPRAPVQSTAGALLPEPGQRSEVVSSSPPPPP
CAQNPLHPSPSHSACKEPVVYPWMRKVHVSTVNPNYAGGEPKRSRTAYTRQQVLELEKEF
HYNRYLTRRRRVEIAHALCLSERQIKIWFQNRRMKWKKDHKLPNTKIRSGGTAGAAGGPP
GRPNGGPPAL
NT seq 753 nt   +upstreamnt  +downstreamnt
atggctatgagttcctttttgatcaactcaaactatgtcgaccccaagttccctccgtgc
gaggagtattcacagagcgattacctacccagcgaccactcgccggggtactacgccggc
ggccagaggcgagagagcggcttccagccggaggcggcctttgggcgccgggcgccgtgc
actgtgcagcgctacgcggcctgccgagaccccgggcccccgccacctccgccgcccccg
ccgcccccgccaccgcccgggctgtcccctcgggctcccgtgcagtcaacagccggggcc
ctcctcccggagcccgggcagcgcagcgaggtggtcagcagcagtcccccgccgcctccc
tgcgcccagaaccccctgcatcccagcccgtcccactccgcgtgcaaagagcccgtcgtc
tacccctggatgcgcaaagttcacgtgagcacggtaaaccccaattacgccggcggggag
cccaagcgctcccggaccgcctacactcgccagcaggtcctggaactggagaaggagttt
cactacaatcgctacctgacgcgacgccggagggtggagattgcccacgcgctctgcctg
tccgagcgccagatcaagatctggttccaaaatcggcgcatgaagtggaaaaaagaccac
aagttgcccaacaccaagatccgctcgggtggtaccgcgggcgcagccggaggcccccct
ggccggcccaacggaggcccccctgcgctctag

DBGET integrated database retrieval system