KEGG   Rattus norvegicus (rat): 498004
Entry
498004            CDS       T01003                                 

Definition
(RefSeq) RGD1565533
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: KIAA1430
Other DBs
NCBI-GeneID: 498004
NCBI-ProteinID: NP_001128073
RGD: 1565533
Ensembl: ENSRNOG00000036796
UniProt: D3ZAA8
Position
10q32.1
AA seq 164 aa
MNNSLDYLAYPVIVSNHRQSTNFRKKLDFGHYILHKNRVQIVKPAVDTSPPMAHTHYILK
LSKLQGEQKRIDKIEYENKQLCQKIANAHRGPAKVDCWNEYLSRSLNRESRNRELVKITM
ENQGILRRLSDRKPHYDRRASEMDWQNSRRYIRNTTRYLLFQEE
NT seq 495 nt   +upstreamnt  +downstreamnt
atgaacaattccctggattatctggcctatcccgtaatagtctctaatcacaggcaaagc
acaaacttcaggaagaaactggactttggccactacatattgcacaaaaatagagttcaa
atagtgaagcctgccgtggataccagtcctccaatggcgcacacacattatattttaaaa
ctgagcaaactccagggtgaacaaaagagaatcgacaaaattgaatatgaaaataaacaa
ttatgtcagaaaattgcgaacgcccatcgaggccctgccaaggtggactgctggaatgag
tatctttcaagaagcttaaacagagaatcaaggaatcgggaactagtaaaaatcaccatg
gaaaaccagggcatcctaaggaggttgagtgatcgcaaaccccactatgaccgcagggca
tcagagatggattggcagaattcaaggcgatatatcagaaacacaacacgatatcttctc
ttccaagaagaatag

DBGET integrated database retrieval system