KEGG   Rattus norvegicus (rat): 498011Help
Entry
498011            CDS       T01003                                 

Gene name
Mrc2, Endo180
Definition
(RefSeq) mannose receptor, C type 2
  KO
K06560  mannose receptor, C type
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    498011 (Mrc2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    498011 (Mrc2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    498011 (Mrc2)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    498011 (Mrc2)
   04090 CD molecules [BR:rno04090]
    498011 (Mrc2)
   04091 Lectins [BR:rno04091]
    498011 (Mrc2)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    498011 (Mrc2)
Pattern recognition receptors [BR:rno04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   498011 (Mrc2)
CD molecules [BR:rno04090]
 Proteins
  498011 (Mrc2)
Lectins [BR:rno04091]
 C-Type lectins
  Group 6: Mannose receptor family
   498011 (Mrc2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C UL45 fn2 Chordopox_A33R
Motif
Other DBs
NCBI-GeneID: 498011
NCBI-ProteinID: NP_001019858
RGD: 1559436
Ensembl: ENSRNOG00000006548
UniProt: Q4TU93
Position
10q32.1
AA seq 1480 aa AA seqDB search
MGPIRPALAPWPRHLLRCVLLLGGLRLGHPADSAAALLEPDVFLIFSQGMQGCLEAQGVQ
VRVIPVCNASLPAQRWKWVSRNRLFNLGAMQCLGTGWPATNTTVSLGMYECDREALSLRW
QCRTLGDQLSLLLGARANNASKPGTLERGDQTRSGHWNIYGSEEDLCARPYYEVYTIQGN
SHGKPCTIPFKYDNQWFHGCTSTGREDGHLWCATTQDYGKDERWGFCPIKSNDCETFWDK
DQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSSTLWIGLN
DLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKK
KPNATAEPIQPDRWANVKVECDPSWQPFQGHCYRLQAEKRSWQESKRACLRGGGDLLSIH
SMTELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDC
VTIWGPEGRWNDSPCNQSLPSICKKAGRLSQGTAEEDHGCRKGWTWHSPSCYWLGEDQVI
YSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFRWLSGDEV
MYTHWNRDQPGYRRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDP
TPSLTGSCPQGWVSDPKLRHCYKVFSSERLQEKKSWIEALGVCRELGAQLLSLASYEEEH
FVANMLNKIFGESEPENHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFARSQHDDDN
IRGCAVLDLASLQWVAMQCQTQLDWICKIPRGVDVREPDIGRQGRLEWVRFQEAEYKFFE
HHSSWAQAQRICTWFQAELTSVHSQAELDFLGQNMQKLSSDQEQHWWIGLHTSESDGRFR
WSDGSVINFVSWAPGKPRPIGKDKKCVYMTARQEDWGDQRCHTALPYICKRSNSSGETRP
HDLPPSTLGGCPSGWNQFLNKCFRIQGQDPQDRVKWSEAQFSCEQQEAQLVTIANPLEQA
YITASLPNVTFDLWIGLHGSQRDFQWIEQEPLLYTNWAPGEPSGPSPAPSGTKPTSCAVI
LHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAAALPAPGTELSYLNRTFRLLQ
KPLRWKDALLLCESRNASLAHVPDPYTQAFLTQAARGLQAPLWIGLASEEGSRRYSWLSE
EPLNYASWQDGEPQHTGGCAYVDVDGTWRTTSCDTKLQGAVCGVSRGPPPPRISYRGSCP
QGLADSSWIPFREHCYSFHTELLLGHKEALQRCQRAGGTVLSILDEMENVFVWEHLQTAE
TQSRGAWLGMNFNPKGGMLVWQDNTAVNYSNWGPPGLGPSMLSHNSCYWIQSSSGLWRPG
ACTNVTMGVVCKLPRVEENGFLPSAALPENPVALVVVLTAAVLLLLALLTGALILYRRRQ
SAERGSFEGARYSRSSRSGPAEATEKNILVSDMEMNEQQE
NT seq 4443 nt NT seq  +upstreamnt  +downstreamnt
atgggacccatccgacctgccctggcgccctggcctcgtcacctgctgcgctgcgtctta
cttctcgggggacttcgtcttggccacccggcagactccgccgccgccctcctggaaccc
gatgtcttcctcatcttcagccaggggatgcagggctgcctggaggcccagggtgtgcag
gtccgagtcatcccagtctgcaatgccagtctccctgcccagcgctggaagtgggtctcc
cggaaccgactcttcaacctgggggccatgcagtgcctgggtaccggctggcctgccacc
aacaccacagtttccctgggcatgtatgaatgtgaccgagaggccttgagtcttcgctgg
cagtgtcgtacactaggggaccagttgtctctgcttctgggggcccgtgcaaacaatgca
tcgaagcctggtaccctggagcgcggcgaccagacccgcagtggccattggaacatctat
ggcagtgaagaagacctatgtgctcgaccctactacgaggtctacaccatccagggaaac
tcccacgggaagccgtgtactatccccttcaaatacgacaaccagtggttccacggctgc
accagcacgggccgggaagatgggcacctgtggtgtgccaccacccaggactacggcaaa
gacgagcgctggggcttctgccccatcaagagtaacgactgtgagacattctgggacaaa
gaccagctgactgacagctgttaccagtttaacttccaatccacactgtcctggagggag
gcctgggccagctgcgagcagcagggtgcagacctgttgagcatcacggagatccacgag
cagacctacatcaatggactcctcacgggctacagctccacgctgtggattggccttaat
gacttggacaccagtggaggctggcagtggtctgacaactcgcccctcaagtacctcaac
tgggagagtgatcagccggacaacccaggtgaggagaactgtggagtgatccggaccgag
tcctcaggtggctggcagaaccatgactgcagcatcgccctgccctatgtctgcaagaaa
aaacccaacgccacagccgagcccatccagccagacaggtgggccaatgtcaaggtggag
tgtgaccccagctggcagcccttccagggccactgctaccgcctgcaggcggagaagcgc
agctggcaggagtccaagagggcgtgcctacggggcgggggcgacctccttagcatccac
agcatgactgagctggagttcatcaccaaacagatcaagcaagaggtggaagagctatgg
attggcctcaatgatttgaagctgcagatgaattttgagtggtctgatgggagcctcgtg
agtttcacccactggcacccctttgagcccaacaacttccgtgacagcctggaagactgt
gtcaccatctgggggccggaaggacgctggaatgacagtccctgtaaccaatccttgccc
tccatctgcaagaaggcaggccgactgagccagggcactgcagaggaggaccatggctgc
cggaagggttggacatggcatagcccatcctgctactggctgggagaggaccaagtgatc
tacagtgatgcccggcgtctgtgtactgaccatggctctcagctggtcaccatcaccaac
aggtttgagcaggccttcgtcagcagcctcatctataactgggagggcgagtacttctgg
acggccctccaagacctcaacagcaccggctccttccgttggctcagtggggatgaagtc
atgtatacccattggaaccgagaccagcctgggtacagacgtgggggctgtgtggctctg
gccacgggcagtgccatgggactgtgggaggtgaagaactgcacgtcgttccgggctcgc
tacatctgccgacagagcctgggcacaccagtgacaccagagttgcctggcccagacccc
acacccagcctcactggctcctgtccccagggctgggtctcagaccccaaactccgacac
tgctataaggtgtttagctcagagcggctgcaggagaagaagagttggatcgaggccctc
ggggtttgccgggagttgggggcccagctgctgagtctggccagctatgaggaggaacat
tttgtggccaacatgctcaacaagatctttggtgagtcagaacctgagaaccatgagcag
cactggttttggattggcctgaaccgcagagaccctagagagggtcacagctggcgctgg
agcgacggtctagggttttcctaccacaattttgcccggagccagcacgatgacgacaat
atccgaggctgtgcggtgctggacctggcctccctgcagtgggtagccatgcagtgccag
acacaacttgactggatctgcaagatccctagaggtgtggatgtgcgggaaccagacatt
ggtcggcaaggccgtctggagtgggtacgctttcaggaggcggagtacaagttttttgag
caccactcctcgtgggcgcaggcacagcgcatctgtacgtggttccaggcagagctgacc
tctgttcacagccaggcagaactggacttcctggggcaaaatatgcagaagttgtcctca
gaccaggagcagcactggtggatcggcctgcacacctcagagagcgacggacgcttcagg
tggtcagatggttctgttataaactttgtctcctgggcaccgggaaaacctcgacccatt
ggcaaggacaagaagtgtgtgtacatgacagctagacaagaggactggggggaccagagg
tgccatacagccttgccctacatctgtaaacgcagcaatagctctggagagactcggcct
cacgacctgccaccgtcaaccctaggaggctgcccctccggctggaaccagttcctcaac
aagtgtttccgaatccagggccaggacccccaggacagggtgaaatggtcagaggcacag
ttctcctgtgaacagcaagaagcccagctggtcaccattgcaaaccccttagagcaagcg
tacatcacggccagcctccccaatgtgacctttgacctctggattggcctgcatggctct
cagagggacttccagtggattgagcaggaacctctgctctataccaattgggcaccagga
gagccctctggacccagccctgctcccagtggcaccaagccgaccagctgtgcggtgatt
ctgcacagcccctcagcccacttcactggccgctgggatgatcggagctgcacagaggag
acgcacggcttcatctgccagaagggcacagacccctcgctgagcccatccccggcagca
gcactccctgccccaggcaccgagctctcctacctcaaccgcaccttccggctgctgcag
aagccactgcgctggaaagatgctctcctgctgtgtgagagccggaatgccagcctggca
cacgtgcctgatccctacacccaggccttccttacgcaggctgcccgggggctgcaagca
ccactgtggatcgggctggccagtgaggagggctcaaggcggtattcctggctctcggag
gagcctctgaattatgcgagctggcaagacggggagccccagcacacagggggctgtgcc
tatgtggatgtggatggaacctggcgcaccaccagctgtgacaccaagctgcagggggca
gtgtgtggggtgagcagagggccccctcctccaaggataagctaccgcggcagctgtcct
cagggcctggctgactcgtcctggattcccttcagggagcactgctactctttccacacg
gagctgctgctgggccacaaggaggcactgcagcgctgccaaagagctggtgggacagtt
ctgtccattcttgatgagatggagaatgtgtttgtctgggagcacctgcagaccgctgaa
acccagagtcggggtgcctggttgggcatgaacttcaatcccaaaggaggcatgctggtc
tggcaagacaatacagctgtgaactattctaactggggcccccctggcctgggccctagc
atgctaagccacaacagctgctactggatccagagcagcagcgggctgtggcgccccggt
gcttgtaccaacgtcaccatgggagttgtctgcaagctccctagagtggaggagaacggc
ttcctgccatcagcagcgcttcctgagaacccggtggccctggtggtggtgctgactgcg
gcagtcctactcctcctggccttgctgacaggggccctcatcctctaccggcgccgacag
agtgcggagcgtgggtcttttgagggggctcgctacagtcgcagcagccgctctggcccg
gcagaggccaccgagaagaacatcctggtttctgacatggaaatgaacgaacaacaagaa
tag

DBGET integrated database retrieval system