KEGG   Rattus norvegicus (rat): 498013
Entry
498013            CDS       T01003                                 

Gene name
Ern1, RGD1559716
Definition
(RefSeq) endoplasmic reticulum to nucleus signaling 1
  KO
K08852  serine/threonine-protein kinase/endoribonuclease IRE1 [EC:2.7.11.1 3.1.26.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04140  Autophagy - animal
rno04141  Protein processing in endoplasmic reticulum
rno04210  Apoptosis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    498013 (Ern1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    498013 (Ern1)
  09143 Cell growth and death
   04210 Apoptosis
    498013 (Ern1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    498013 (Ern1)
   05012 Parkinson disease
    498013 (Ern1)
   05014 Amyotrophic lateral sclerosis
    498013 (Ern1)
   05016 Huntington disease
    498013 (Ern1)
   05017 Spinocerebellar ataxia
    498013 (Ern1)
   05022 Pathways of neurodegeneration - multiple diseases
    498013 (Ern1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    498013 (Ern1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    498013 (Ern1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     498013 (Ern1)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.-  
     498013 (Ern1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  IRE family
   498013 (Ern1)
SSDB
Motif
Pfam: Pkinase Ribonuc_2-5A PK_Tyr_Ser-Thr PQQ_2 PQQ Pkinase_fungal Kdo APH
Other DBs
NCBI-GeneID: 498013
NCBI-ProteinID: NP_001178855
RGD: 1559716
Ensembl: ENSRNOG00000012864
UniProt: F1LSY7
Position
10q32.1
AA seq 965 aa
MRRCNDIQSFGRASTVTLPEALLFVSTLDGSLHAVSKRTGSIKWTLKEDPVLQVPTHVEE
PAFLPDPNDGSLYTLGGKNNEGLTKLPFTIPELVQASPCRSSDGILYMGKKQDIWYVIDL
LTGEKQQTLSSAFADSLCPSTSLLYLGRTEYTITMYDTKTRELRWNATYFDYAASLPEDD
VDYKMSHFVSNGDGLVVTVDSESGDVLWIQNYASPVVAFYIWQREGLRKVVHINVAVETL
RYLTFMSGEVGRITKWKYPFPKETEAKSKLTPTLYVGKYSTSLYASPSMVHEGVAVVPRG
STLPLLEGPQTDGVTIGDKGECVITPSTDLKFDPGLKGKSKLNYLRNYWLLIGHHETPLS
ASTKMLERFPNNLPKHRENVIPADSEKRSFEEVINLVGQTSENTPTTVSQDVEEKLPRAP
AKPEAPVDSMLKDMATIILSTFLLVGWVAFIITYPLSMHQQRQLQHQQFQKELEKIQLLQ
QQQLPFHPHGDLTQDPDFLDSSGLFSESSGTSSPSPSPRASNHSLNSSSSASKAGTSPSL
EPDDEDEETRMVIVGKISFCPKDVLGHGAEGTIVYKGMFDNRDVAVKRILPECFSFADRE
VQLLRESDEHPNVIRYFCTEKDRQFQYIAIELCAATLQEYVEQKDFAHLGLEPITLLHQT
TSGLAHLHSLNIVHRDLKPHNILLSMPNAHGRIKAMISDFGLCKKLAVGRHSFSRRSGVP
GTEGWIAPEMLSEDCKENPTYTVDIFSAGCVFYYVISEGNHPFGKSLQRQANILLGACSL
DCFHSDKHEDVIARELIEKMIAMDPQQRPSAKHVLKHPFFWSLEKQLQFFQDVSDRIEKE
SLDGPIVRQLERGGRAVVKMDWRENITVPLQTDLRKFRTYKGGSVRDLLRAMRNKRHHYR
ELPLEVQETLGSIPDDFVRYFTSRFPHLLSHTYRAMELCRHERLFQTYYWHEPTEAQPPG
IPDAL
NT seq 2898 nt   +upstreamnt  +downstreamnt
atgcgcaggtgcaatgacatacaaagttttggaagagccagcacagtaacactgcctgaa
gccttgttatttgtttccaccctggacggaagtttgcatgctgtcagcaagaggacaggc
tccatcaagtggactttaaaagaagatccagtcctgcaggtcccaacacacgtggaagag
cctgctttcctcccagaccccaatgatggcagtctgtacacacttggaggcaagaacaat
gaaggcctgacgaaacttccctttaccatcccggaattggttcaggcatccccatgccga
agttcagatggaattctctacatgggtaagaagcaagacatttggtatgtcatcgacctc
ctgactggcgagaagcagcagactttgtcatcagccttcgcagacagtctgtgcccgtca
acttcccttctgtatcttggacggacagaatacaccatcaccatgtatgacaccaagacc
cgggagctccgctggaatgccacctattttgactatgcagcctcacttcccgaggatgac
gtggactacaagatgtcccactttgtgtccaatggcgatggactggtggtaactgtggac
agtgaatctggggatgtcttgtggatccaaaactatgcctctcctgtggtggccttctac
atctggcagcgggagggcctgagaaaggtggtgcacatcaacgttgctgtggagacccta
cgctatttgaccttcatgtctggggaagtggggcgcatcaccaagtggaaatatccattc
cccaaggagacagaggccaagagcaaactgacgcccactctgtatgtggggaagtactcc
accagcctctatgcctcgccctcgatggtgcacgagggggtcgctgttgtgcctcgaggc
agcactcttcctttgctcgaaggaccccagacagatggtgtcaccattggagacaaagga
gaatgtgtgatcactcccagcacagacctcaagtttgaccctggactcaaaggcaagagc
aagctgaactacctgaggaattactggcttctcataggacaccatgaaactcctctgtct
gcatccaccaagatgctggagagatttcctaacaatcttcccaaacatcgagaaaacgtg
attcctgctgattcggagaaaaggagctttgaggaggttatcaacctagttggccagact
tcagaaaacacaccaaccactgtgtctcaggatgtagaagagaagctgccccgtgccccc
gccaagccagaggcccccgtggactccatgctcaaggacatggctactattatcctgagc
accttcctgctggtcggatgggtggcgttcatcatcacttaccccctgagcatgcatcag
cagcgccagctccagcaccagcagttccagaaggaactggagaaaattcagctccttcag
caacagcagctgcccttccacccacacggagaccttacccaggaccctgacttcctggat
tcatctggcctcttctcggagagctcaggcaccagcagccccagcccatcccccagagcc
tccaaccactcactcaactctagcagctctgcctccaaggctggcaccagtccctccctg
gagccagatgacgaggatgaggaaaccagaatggtgattgttgggaaaatctcattctgc
cccaaggatgtcctgggccatggagctgagggcacaattgtatacaaaggtatgtttgac
aaccgtgatgtggccgtgaagaggatcctccctgagtgttttagctttgcagaccgagag
gtccagctgcttcgagaatcagacgagcatccgaatgtgatccgctacttttgcacagag
aaggaccggcagttccagtacattgccattgagctgtgtgcagctaccctgcaggagtat
gtggagcagaaggacttcgcccaccttggcctagagcccatcaccttgcttcatcagacc
acctcaggcctggcgcacctgcattccctcaacattgttcacagagacctgaagccccac
aacattctcctctccatgcccaacgcacatggcaggatcaaggcgatgatctcagacttt
ggcctctgcaagaagctggcagtgggcaggcatagtttcagccgccgttcaggggtgcct
ggcactgaaggttggatcgccccagagatgctgagtgaagactgcaaggagaaccctacc
tacacagtggacatcttctctgcaggctgtgtcttttactatgtcatctctgagggcaac
catccttttggcaaatccttgcagcggcaggccaacatcctcctgggcgcctgcagcctt
gactgcttccactcagacaagcacgaggacgtcattgctcgtgagttgatagagaaaatg
attgcaatggatccgcagcagcgaccctcggcaaagcacgtgctaaaacacccattcttc
tggagcctggaaaagcagctccagttcttccaggatgtgagtgaccgaatagaaaaggag
tccttggatggcccgatcgtgcggcagttggagagaggcgggagagctgtggttaagatg
gactggcgggagaacatcactgtccccctgcagacagatctgcgcaaattcagaacctat
aaaggtggctccgtccgggatctcctccgagccatgaggaataagagacaccactaccgg
gagctccctctggaggttcaggagacgctgggctccatccctgatgacttcgtgcgctac
ttcacatcacgtttcccccacctcctctctcacacctaccgagccatggaactgtgcaga
catgagagacttttccagacctactactggcacgagcccacagaagcccagcctccaggg
attccagatgccctctga

DBGET integrated database retrieval system