KEGG   Rattus norvegicus (rat): 498146Help
Entry
498146            CDS       T01003                                 

Gene name
Spdye4
Definition
(RefSeq) speedy/RINGO cell cycle regulator family member E4
  KO
K08694  speedy
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04114  Oocyte meiosis
rno04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    498146 (Spdye4)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    498146 (Spdye4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spy1
Motif
Other DBs
NCBI-GeneID: 498146
NCBI-ProteinID: NP_001029325
RGD: 1561076
Ensembl: ENSRNOG00000058563
UniProt: Q3KR78
Position
12p11
AA seq 231 aa AA seqDB search
MAASGPSSQSEEQCPQLSTTMASPVMDDDIPGLSEPRVEARSQPPSSSPKRKRDLSSDSE
DDLAELLEPDPQPVWSVETLCGLRMRLKRRRVSTVRPEHHKVFTRLLEDPVVKKFLNWDK
MLRVSDKYLLSMVIAYFSRAGLFSWQYRPIHFFLALYLANDMEEDNQAPKQDIFYFLYGK
SYAQRPMFHKLRFQFIRSMGWRIWVSREECEEIQAYNPDLWVWARDRTNLT
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggctgccagtggaccttcctcacagtctgaggaacaatgtcctcagctgagcaccacg
atggcctcaccggtgatggatgatgatatcccaggactatcagaaccaagggtggaagcc
aggtcccagcctccatccagcagcccaaagcggaagagggacttgtcatcggattctgag
gatgacctggcagagctactggaaccggatccccagccggtgtggtcagtggagacactg
tgcgggctcaggatgaggctgaagaggcgacgtgtgtctacagtgcgtcctgaacaccac
aaggtcttcaccaggctgctcgaggatcccgtggtgaaaaaattcctgaactgggacaag
atgctgagggtgtcagacaagtatctcctgtctatggtcatagcttatttcagccgcgct
gggcttttctcctggcagtataggccaatccacttcttcctggctctgtacctggccaat
gacatggaggaggacaaccaggcccctaaacaagacatcttttacttcctctacgggaag
agctacgcccagcgcccgatgttccacaaactgcgcttccagttcattcgctccatgggc
tggaggatctgggtgtcccgggaggagtgtgaagagatccaggcttacaatccagatctc
tgggtgtgggcacgagatcgcaccaacctgacctag

DBGET integrated database retrieval system