KEGG   Rattus norvegicus (rat): 498159Help
Entry
498159            CDS       T01003                                 

Gene name
Spry3, RGD1562172
Definition
(RefSeq) sprouty RTK signaling antagonist 3
  KO
K17384  protein sprouty homolog 3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    498159 (Spry3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sprouty
Motif
Other DBs
NCBI-GeneID: 498159
NCBI-ProteinID: NP_001102533
RGD: 1562172
Ensembl: ENSRNOG00000060153
UniProt: B5DF90
Position
12q11
AA seq 281 aa AA seqDB search
MATDDPQPILPIAQLRSVHASNDYVDRPPAPRKPTLSSPSLTLQTHKSDWSLATTPTALP
RSVSQCHQLQPLPQHLSQSSIASSVSQTTTASDQRLLATMTPSPSGPSSILRTHPKVDGA
LKGGAEQSAGQSSDHRLFICEECGRCKCVPCTAVRPLPSCWVCNQRCLCSAESLLDYGTC
LCCVQGVFYHCSTDDEDNCADEPCSCGPGSRFLRWAAMGVISVFLPCLCCYLPTRGCLRL
CQRGYDSLRRPGCRCKMHTNTVCRKMSSGGSPCPKAQEKSV
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagatgacccccaaccgattctgcccattgcacagctgcgctctgttcacgcc
agcaatgattacgtggaccggcctccggcaccccgcaaaccaactctttccagcccttcc
ctgactctgcaaacccacaagtctgattggtccctggcgaccacgcccaccgcgctcccg
cgcagcgtcagccagtgccatcagctgcaacccctgcctcagcatctcagccaatccagc
attgccagctccgtgtcgcaaaccaccactgcctctgaccaaaggctcttggccaccatg
acaccctctccttcaggcccgtcgtccatcctcagaacccacccgaaggtcgacggtgct
ctgaagggaggagctgagcagtcggctgggcagtccagtgatcatcgcctcttcatctgc
gaggagtgcgggcgctgcaagtgcgtcccctgcacggcggtccgccccctgccctcctgc
tgggtgtgcaaccagcgttgcctttgctccgccgagagcctcctcgactacggcacctgc
ctttgctgtgtccagggcgtcttctaccactgctccaccgacgacgaggacaactgcgcc
gacgagccctgctcctgcgggcccggctctcgcttcctccgctgggcggccatgggtgtc
atctccgtcttcttaccctgcctgtgctgctacctgcccacccgggggtgcctccgcctg
tgccagcggggctatgacagcctccgacggccgggctgccgctgcaaaatgcacaccaac
accgtgtgcagaaaaatgtcttccgggggctcaccctgccccaaggcccaagagaagtcg
gtatga

DBGET integrated database retrieval system