KEGG   Rattus norvegicus (rat): 498189Help
Entry
498189            CDS       T01003                                 

Gene name
Srrm4, RGD1560213
Definition
(RefSeq) serine/arginine repetitive matrix 4
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: SRRM_C
Motif
Other DBs
NCBI-GeneID: 498189
NCBI-ProteinID: NP_001333235
RGD: 1560213
UniProt: F1M2T7
Position
12q16
AA seq 602 aa AA seqDB search
MASLQQGEKQLFEKFWKGTFKAVATPRPESIIVASITARKPMPRTETQSSLLLPDQDGPS
EKLGQRLATEALGTNSWGREKACRELGPARAHSASQDRDPTPPPSSRGKKKKKKSTRKKR
RRSPSYSPSPVKKKKKKSSKKHKRHRSFSKKRRHSSCSPKSKRREEKRHKKQSRSRKSHR
HRHHRCPSRSQSSELRSPSCESRHRGRSPEEGRKSRRTHSRRCSKNHCKVSPEARSSHLP
SQPLQRLGFLSARGVISGSGSTADLFSKSASPLAASRGRSQEYDSGNDTSSPPSTQTSSA
RSQGQEKGSPGGELSKSRDLNCGNTSDSGNSFTTSSPQNKGAVLENVSPACRSSESRGFQ
SPCLQCAEVKKSSLVPSTARSSPIKECSRSSSYTSTRSSSPSSRSPNPRASPGSTRSRST
SSEKRSYSRSPSYSSKSGKRSPPSRSSRSRRSPSYSRYSPSRERDPKYGEKEPQPRERAR
RRRRSYSPMRKRRRDSPSHLEARRITSARKRPIPYYRPSPSSSSSLSSASSWYSSSSSRS
ASRSYSRSRSPSRNRSSRSQTRSRTRTSRSSSSRSLSLGSRSRSRNRSLSYSSAESYAST
RR
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcctgcagcaaggcgagaaacagctgtttgagaagttctggaaagggaccttc
aaagcagtggccactccgcgtcccgagagcatcatcgtcgccagtatcacagcccgcaag
ccgatgccaaggacagagacacagagcagtctcctgctcccagaccaggacggaccttca
gagaagctgggccaacgtctggccactgaggcccttggtaccaacagctggggaagagag
aaagcctgcagggagctgggtcctgccagagcacacagtgcctctcaagacagagacccg
acaccaccaccttcctccagggggaaaaagaaaaagaagaaatcgaccaggaaaaagagg
aggaggtccccatcgtacagcccctctccagtcaagaagaagaagaagaaaagctccaag
aaacataagcgacacaggtctttctccaagaaaaggagacacagttcctgcagccctaaa
agcaaaagacgggaagagaagaggcacaaaaaacaatctcgaagccggaagtctcaccga
catagacatcaccgatgcccctcaaggtcccagagctcagaactgcgctcccccagctgc
gagagcaggcaccgaggtcggtctcctgaggaagggcggaaatcccgccgaacacattcc
cgacgctgctccaagaaccactgcaaggtcagcccagaggcccggtccagccacctgccc
agccagcccctccagaggctcggcttcctgtcagccaggggtgtaatctctgggtcgggg
tccacggctgatctctttagcaaatcggccagcccgctcgccgcctcccgagggcgctcg
caggagtacgactcgggcaatgacacgtcctcgccgccctccacgcaaaccagctcggcc
aggtctcagggccaggagaaggggagccccggtggggagctgagcaagagccgggacctc
aactgcggcaacacttccgattcagggaactccttcaccacatcctccccccagaacaag
ggggctgtcttagagaatgtctctcccgcctgcaggagcagtgagtcaagagggtttcag
tctccatgtctccagtgcgcagaggtgaagaagtctagtttggtcccatccacagcccgg
agctcccccattaaagagtgctcccgtagctcctcctacaccagtactcggtcctccagt
ccctcatccaggtctccaaatcccagagcctcccccgggtccacccggagccggtccacc
tcctctgaaaaaaggtcctactctcgctctcccagctattcttccaagtctggcaagagg
agcccacctagcagaagctccaggtctcgtcgaagtccgagctactcccgctacagcccc
agcagggaacgggacccaaagtatggtgagaaggaaccacagccccgagaacgtgcacgc
aggaggcgaaggtcctactcgcctatgaggaagcgccggagagactccccaagccacttg
gaggcccggaggataaccagtgcccgcaaacgccccatcccctactaccgacccagcccc
tcctcctccagcagcctcagcagcgcctcctcctggtacagcagcagcagcagccgctct
gctagccgcagttactcccggagccggagtcccagtcggaaccgcagcagccgaagccag
accaggagcaggacgcggaccagccgcagctccagctcccgcagcctcagcctgggctcc
cggagccgcagtcggaaccggagcctgagctacagctcagcagaaagctatgccagcacg
aggcgttaa

DBGET integrated database retrieval system