KEGG   Rattus norvegicus (rat): 498206
Entry
498206            CDS       T01003                                 

Gene name
Tnfrsf11a, RANK, RGD1563614
Definition
(RefSeq) TNF receptor superfamily member 11A
  KO
K05147  tumor necrosis factor receptor superfamily member 11A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04064  NF-kappa B signaling pathway
rno04380  Osteoclast differentiation
rno04917  Prolactin signaling pathway
rno05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    498206 (Tnfrsf11a)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    498206 (Tnfrsf11a)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    498206 (Tnfrsf11a)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    498206 (Tnfrsf11a)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    498206 (Tnfrsf11a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    498206 (Tnfrsf11a)
   04090 CD molecules [BR:rno04090]
    498206 (Tnfrsf11a)
Cytokine receptors [BR:rno04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   498206 (Tnfrsf11a)
CD molecules [BR:rno04090]
 Proteins
  498206 (Tnfrsf11a)
SSDB
Motif
Pfam: RANK_CRD_2 TNFR_c6 Chordopox_A13L Sec66
Other DBs
NCBI-GeneID: 498206
NCBI-ProteinID: NP_001258164
RGD: 1563614
Ensembl: ENSRNOG00000015615
UniProt: F1M8Z6
Position
13p11
AA seq 633 aa
MAPRARRRRQFPAPLLALCVLLLPLQVTLQVTLPCTQERHYEHLGRCCSRCEPGKYLSSK
CTPTSDSVCLPCGPDEYLDTWNEEDKCLLHKVCDAGKALVAVDPGNHTAPRRCACTAGYH
WNADCECCRRNTECAPGFGAQHPLQLNVDTVCTPCLLGFFSDVFSSTDKCKPWTNCTVLG
KMEAHQGTTESDVVCSSSLTLIKPPKEAQVYLPSLIVLLLFISVVVVAAIVFSIYYRKGG
KTLTANLWNWVNDACSSLSGNKESSGDHCVGSHSANSSQQEVCEGILLMTREEKMVPEDC
AGVCGPVRAASGPWAEGRDARTFTLVSEVETQGNLSRKIPTEDEYTDRPSQPPNGSLFLI
QPGSRSTPPFQEPLEVGENDSLSQCFTGTESMVDSEGCDFTEPPSRTDYMPASPEKLLTK
EIEDDSCLPWVANSNSTDGYTGSGNTPGEDHEPLPGSLKCGPLPQCAYSIGLPSEAAASL
AEVGAQPQDRADAKLPSSERGASGSGSSPSEQPPASGNVTGNSNSTFISSGQVMNFKGDI
IVVYVSQTSQEGPGPAEPEPEPEPVGRPVQEETLAHRDSFAGTAPRFPDACTTGAGLQEK
GASRPKDWASRPVQEQGGAQASLNTQGSGQCAE
NT seq 1902 nt   +upstreamnt  +downstreamnt
atggccccgcgcgcccggcggcgccgccagtttcccgcgcctctgctggcgctctgcgtg
ctgctcctcccattgcaggtgaccctccaagtcactctgccgtgcacccaggagaggcac
tatgagcatcttggacggtgttgcagcagatgcgaaccaggaaagtacctgtcttctaaa
tgcactcccacctccgacagtgtgtgtctgccctgtggcccagatgaatacttggatacc
tggaatgaagaagataaatgcttgctgcataaagtctgtgatgcaggcaaggccctggtg
gcggtggaccctggcaaccacacggccccgcgtcgctgtgcctgcacggcgggctaccac
tggaacgcagactgcgagtgctgccgtcggaacacggagtgcgcaccgggcttcggagct
caacatcccttgcagctcaacgtggataccgtgtgcacaccctgcctcctgggcttcttc
tcagatgtcttttcgtcaacagacaaatgcaaaccctggaccaactgcaccgtccttggg
aagatggaagcacaccaagggacgacggaatcagatgtggtctgcagctcttccctgaca
ctcataaaaccacccaaggaggcccaggtttacttgcccagtctcatcgtcctgctcctc
ttcatctctgtggtagtggtggctgccatcgtcttcagcatttactacaggaagggaggg
aaaacgctgacagctaatctgtggaattgggtcaatgatgcttgcagtagtctcagtgga
aataaggagtcctcaggggaccattgtgttggttcccactcggcaaactccagccagcaa
gaagtgtgtgaaggtatcttactaatgactcgggaggagaagatggttccagaagactgt
gctggagtctgtggacctgtgcgtgcggcaagtgggccctgggcagaaggcagagatgct
aggacgttcaccttagtcagcgaggttgagacgcaggggaacctctcaaggaagatcccc
acagaagatgagtacacggaccggccctcacagcctccgaatggttcactgttcctaatc
cagcctggaagcagatcgacacccccgttccaggagcccctggaagtgggggagaacgac
agtttaagccagtgtttcacggggacggaaagcatggtggattccgaaggctgcgacttc
accgagcctccaagcagaactgactatatgcctgcatcccctgaaaagctcctgacaaaa
gaaatagaggatgacagttgcctaccctgggtggccaactccaactcaacggatggctac
acaggcagtgggaacactcctggggaggaccatgaaccccttccggggtccctgaaatgt
ggaccgttgccccagtgtgcctacagcataggccttcccagtgaagcagcagccagcttg
gcagaggtcggagcgcagccccaggacagggctgatgcaaagcttccgagctcagagagg
ggagcctcggggtctgggagttcgcccagtgaacagccacctgcctctggaaacgtgaca
ggaaacagtaactccacgttcatctccagcgggcaggtgatgaacttcaagggtgacatc
atcgtggtgtacgtcagtcagacctcacaggagggcccggggcctgcagagccagagcca
gagccggagcccgtgggccgcccagtgcaggaggagacactggcacacagagactccttt
gcgggcaccgcaccgcgcttccccgacgcatgcaccaccggggctgggttacaggagaag
ggggcatctcggccgaaggactgggcatcacggccggtgcaggagcagggtggggcgcag
gcttcactcaatacccaggggtccggacaatgtgcagaatga

DBGET integrated database retrieval system