KEGG   Rattus norvegicus (rat): 498230
Entry
498230            CDS       T01003                                 

Gene name
Golt1a, RGD1566310
Definition
(RefSeq) golgi transport 1A
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Got1
Other DBs
NCBI-GeneID: 498230
NCBI-ProteinID: NP_001102540
RGD: 1566310
Ensembl: ENSRNOG00000002936
Vega: OTTRNOG00000000633
UniProt: D3ZFB0
Position
13q13
AA seq 133 aa
MISITEWQKIGVGITGFGVFFILFGILLYFDSVLLAFGNLLFLTGLSLIIGLRRTFSFFF
QRHKLKGTSFFLGGVAIVLLRWPLLGMLLEAYGFVSLFKGFFPVVFGFLGNAFNIPFLSA
LFQRLQGSSSSMV
NT seq 402 nt   +upstreamnt  +downstreamnt
atgatctccatcacagagtggcagaaaattggcgtgggcatcaccggcttcggcgtcttc
ttcatcctctttgggatactcttgtacttcgattccgtgctcttggcttttggaaacctg
ctgttcctgactggcctctccctcatcatcggcctgaggagaacgttttccttcttcttc
caacggcacaagctcaagggaacaagcttcttcctgggcggtgtcgccattgtgctgctg
cgctggcccctgctaggcatgctcttggaggcctatgggttcgttagcctcttcaagggg
tttttccctgtagtctttggcttcctgggcaatgcatttaacatccccttcctgagcgca
ctgttccagaggcttcaaggctcctccagctcaatggtctga

DBGET integrated database retrieval system