KEGG   Rattus norvegicus (rat): 498233Help
Entry
498233            CDS       T01003                                 

Gene name
Lgr6, RGD1560339
Definition
(RefSeq) leucine-rich repeat-containing G protein-coupled receptor 6
  KO
K08399  leucine-rich repeat-containing G protein-coupled receptor 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    498233 (Lgr6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    498233 (Lgr6)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Others
   R-spondin
    498233 (Lgr6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_5 LRR_4 LRR_9 LRRNT 7tm_1
Motif
Other DBs
NCBI-GeneID: 498233
NCBI-ProteinID: XP_001062538
RGD: 1560339
Ensembl: ENSRNOG00000005093
UniProt: D3ZJU9
Position
13q13
AA seq 965 aa AA seqDB search
MHSSPLLLALCLCVVLCALARAGSDPQPGPGRPACPAPCHCQEDGIMLSADCSELGLSEV
PADLDPLTAYLDLSMNNLTELQPGLFHHLRFLEELRLSGNHLSHIPRQAFSGLHSLKILM
LQSNQLRGIPAEALWELPSLQSLRLDANLISLVPERSFEGLSSLRHLWLDDNALTEIPVR
ALNNLPALQAMTLALNRIRHIPDYAFQNLTSLVVLHLHNNRIQHVGTHSFEGLHNLETLD
LNYNELQEFPVAIRTLGRLQELGFHNNNIKAIPEKAFMGNPLLQTIHFYDNPIQFVGRSA
FQYLSKLHTLSLNGATDIQEFPDLKGTTSLEILTLTRAGIRLLPAGMCQQLPRLRILELS
HNQIEELPSLHRCQKLEEIGLQHNRIWEIGADTFSQLSSLQALDLSWNAIRAIHPEAFST
LRSLVKLDLTDNQLTTLPLAGLGGLMHLKLKGNLALSQAFSKDSFPKLRILEVPYAYQCC
AYGLCANFFKTSGQWQAEDFHAEEEEAPKRPLGLLAGQAENHYDLDLDELQMETEDSKPH
PSVQCSPVPGPFKPCEHLFESWGIRLAVWAIVLLSVLCNGLVLLTVFAGGPSPLSPVKLV
VGAIAGANALTGISCGLLASVDALTFGQFAEYGARWETGLGCQATGFLAVLGSEASVLLL
TLAAVQCSVSVTCVRAYGKAPSPGSVRAGALGCLALAGLAAALPLASVGEYGASPLCLPY
APPEGRPAALGFAVALVMMNSLCFLVVAGAYIKLYCDLPRGDFEAVWDCAMVRHVAWLIF
ADGLLYCPVAFLSFASMLGLFPVTPEAVKSVLLVVLPLPACLNPLLYLLFNPHFREDLRR
LWPSPRSPGPLAYTAAGELEKSSCDSTQALVAFSDVDLILEASEAGQPPGLETYGFPSVT
LISRHQPGATRLEGNHFVEPDGTKLGNPQPPMNEELLLRAEGATLADCSAGGALWPSGPL
FASHL
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atgcacagctcgccgttgctcctggcgctgtgtctttgcgttgtgctgtgcgcattggcg
cgcgcgggcagcgacccccagcctggcccggggcgtcccgcctgccccgctccctgccac
tgccaggaggatggcatcatgctgtcagctgactgctccgagctcggtctctcagaggtg
ccagcggacctggaccccctgacggcttacctagacctcagtatgaacaacctcacggag
cttcagccgggtctcttccaccacctgcgcttcctggaggagctgcggctctcggggaac
cacctctcacacatcccaagacaggcattctctggcctccacagcctcaaaattctgatg
ctgcagagcaaccagctccgagggatcccagcagaggcgctgtgggagctgcccagcctg
cagtcgctgcgcctagatgctaacctcatctccctggtccctgagagaagctttgagggg
ctgtcctccctccgccacctctggttggatgacaatgcactcaccgagatccctgtcaga
gctctcaacaaccttcctgccctacaggccatgaccttggctctcaaccgcatccgccac
atccctgactatgccttccagaacctcaccagtcttgtggtgctgcatctacataacaac
cgcatccagcatgtggggacccacagcttcgaggggctgcacaatctggagacactagac
ttgaactataatgagctgcaggagttccccgtggctatccggaccctgggcaggctgcag
gaattgggtttccacaacaacaacatcaaggctatcccagagaaggccttcatgggcaac
cctctcctgcagacaatacacttttatgacaacccgatccagtttgtgggaaggtcagca
ttccagtacctgtctaaactgcatacgctatccttgaatggtgccactgacatccaggag
ttcccagacctcaaaggcaccactagcctggagattctgaccctgacccgtgcaggcatc
agactgctcccagcgggaatgtgtcaacagctgcctaggctccgaatcctggagctgtct
cataatcagattgaggagctacccagcctgcacaggtgtcagaagttggaggaaattggc
ctccagcataaccggatctgggaaattggtgcagataccttcagccagctgagttccttg
caagctctagatctgagttggaatgccatccgtgccattcaccccgaggctttctcaacc
cttcgatccttggttaagctggacctgactgacaaccagctgaccacactgcccctggct
gggctgggaggcctgatgcacctgaagctcaaggggaacttggccctgtctcaggccttc
tccaaggacagtttccccaaactgaggatcctggaggtgccttacgcctaccagtgctgt
gcctatggcctctgtgccaacttcttcaagacctctgggcagtggcaggccgaggacttt
catgcagaggaagaagaggcaccaaagaggcccctgggtctccttgctggacaagctgag
aaccactatgacctagacctggatgagctccagatggagacagaggactcaaagccacac
cccagtgtccagtgcagccctgttccaggccccttcaagccctgcgagcacctctttgag
agctggggcatccgccttgctgtgtgggccatcgtgctgctctcggtactctgtaacggg
ctggtgctgcttacagtctttgctggcgggcccagcccgttgtctccggtcaagcttgtg
gtgggtgcgatcgctggcgccaacgccctaacgggcatttcctgcggcctcctggcctca
gtggacgccttgaccttcggccagttcgcggagtatggagcccgctgggagaccgggcta
ggctgccaggctacgggcttcctagccgtcctggggtcggaggcgtcggtgctgctgctc
acgctggcggccgtgcagtgcagcgtctctgtgacctgcgtccgggcctacgggaaggcg
ccgtcgcccggtagcgtccgcgcaggcgcactgggatgcttggcgctggctgggctggcc
gccgcgctgccgctggcctcggtgggggagtatggtgcctccccgctctgcctgccctac
gcccctcccgagggccgcccggccgccctaggcttcgccgtagccctggtgatgatgaac
tcgctctgcttcctcgtggtggccggtgcctacatcaagctctactgcgacctgcctcgg
ggtgactttgaggccgtgtgggactgcgccatggtgcggcatgtggcctggctcatcttt
gcagatggccttctctactgccccgtggccttcctcagctttgcctccatgctgggcctc
ttcccggtcacccctgaggctgtcaagtcggttcttctggtggtgttgcctctgcccgcc
tgcctgaacccactgctctacctgctcttcaaccctcacttccgggaagaccttcggagg
ctctggccgagccctcggtccccagggcctctagcttatactgcagccggtgagctggag
aagagctcctgcgactccacccaagccctggtggctttctctgatgtggatcttattctg
gaagcttctgaggctgggcagcctcctgggctagagacctatggcttcccttcagtgacc
ctcatctcccgtcatcagccaggggctaccaggctggagggaaaccattttgtggagcct
gatggaaccaagttagggaacccacaacctcccatgaatgaagaactgctgctgagggca
gagggagccacactggcagactgttctgcaggtggagccctctggccctctggccctctc
tttgcctctcacttgtaa

DBGET integrated database retrieval system