KEGG   Rattus norvegicus (rat): 498241Help
Entry
498241            CDS       T01003                                 

Gene name
RGD1564614
Definition
(RefSeq) similar to complement factor H-related protein
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Sushi Sushi_2 Sipho_tail
Motif
Other DBs
NCBI-GeneID: 498241
NCBI-ProteinID: NP_001128264
RGD: 1564614
Ensembl: ENSRNOG00000042369
UniProt: G3V7P5
Position
13q13
AA seq 699 aa AA seqDB search
MRFYSIWLLANILLITSLSTAKGEEECVLHYVENGYSLFLERKFVQDQSVKVNCYKGFNL
PNGQDTITCTESGWTPQPICIPSETCSKSDIEIDNGFFSESDLTYAVNRKTRYVCKQGYT
TANGERSGSITCLQTGWSAQPSCIKSCDVPVFENAKSKNDSTWFKLNDKLDYECHIGYEN
KYKHTKGSIMCTTDGWSDKPSCYEIECSIPILDPRLVVYPRKIKYTVGDLLKFSCRPGHR
VGPDSVQCYDFGWSPSFPTCKGQVRSCGQYPELLNGEIKGTKKAEYSHGDVVEYDCKPRF
LLKGPNKIQCVDGKWTTLPTCVEEKRTCGDIPALEHGSVKFSVPPYHHGDSVEFTCAETF
TMIGQRSVSCISGRWAQLPRCVATVQLEKCKAPRLAVIGANKLEKDGLNHNSSISYKCRG
SQKYGYSICINGRWDPEPTCTRKEKAFCPPPPQIPNAQVIDTTVKYLDGEKVSVLCQDGY
LTQGPEEMVCKHGRWQSLPRCTAKITCSQPPKIDHGSIKLPRLSDAGRDAIDSSSHEHGT
TFSYVCDDGFRISKENGVTCHMGKWSSPPRCVESTGKCGPPPTIENGDITSLSLPVYAPL
SSVEYQCQSFYKMQGSKKITCKNGEWEEPPKCLHACVLTEEIMRRQNIIPKRTKNKKIYI
QSGDYVEFVCLTAYQKAQGSPEFRTQCIDGHINYPTCSK
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgaggttctatagcatatggctcttagcaaatattctcctaatcacatcactttctact
gctaaaggggaagaggaatgtgttttgcattatgtggaaaatggttattctttattcttg
gaaagaaaatttgtacaagatcagtctgtcaaagtcaactgttataaaggcttcaacctt
ccaaatggtcaggatacaattacatgtacagagagtggctggacacctcaacccatatgc
atcccttctgagacatgctcaaagtcagatatagaaattgataatggatttttttctgaa
tctgatttaacatatgctgtaaatagaaaaacacgatatgtgtgtaaacagggatataca
acagcaaatggagaaagatcgggatcaatcacttgcctacaaactggatggtctgctcaa
ccttcttgcattaagtcttgtgatgtgcctgtgtttgagaatgctaaatctaaaaatgat
agcacatggtttaaactcaatgacaaattagattatgaatgtcacattggatatgaaaat
aaatataagcataccaaaggctccataatgtgtactactgatggatggtctgataaaccc
tcatgttatgaaattgaatgcagcattcccatattagacccacgcttagttgtttatccc
aggaaaataaaatatacagttggagatttgttgaaattctcttgccgaccaggacacaga
gttggaccagattcagtgcaatgctatgactttggatggtcccctagttttccgacatgt
aaaggtcaagtaagatcatgtggtcaatatcctgaactactcaatggggaaataaaggga
acaaagaaagctgaatacagccatggtgacgtggtggagtatgattgcaaacctagattt
ctactgaagggacccaataaaatccagtgtgttgacgggaagtggacaaccttgccgaca
tgcgttgaggagaaaagaacatgtggagacattcctgcacttgagcatggctctgtcaag
ttttctgtccctccctaccaccacggagattcagtggagtttacttgtgcagaaaccttc
acaatgattggacagagatcagtttcttgcattagtgggaggtgggcccagcttcctcga
tgtgttgcaacagtacaacttgagaagtgtaaagcaccgagactggctgtaataggggca
aataaactcgagaaggatggattgaatcataactctagcatcagttacaaatgtagagga
agtcagaagtatggatattcaatctgcattaatggaagatgggatcctgaaccaacctgt
acaagaaaagagaaagcattctgccctcctcccccacagattccaaatgcccaagtgatt
gataccacagtgaaatacttggatggagagaaagtatctgttctttgccaagatggttac
ctaactcagggcccagaagaaatggtgtgtaaacatggaaggtggcagtcgttaccacgc
tgcacggcaaaaattacatgttcccagccccctaaaatagaccacggatctattaagtta
cccagattgtcagatgcaggaagagatgcaattgactccagcagtcatgaacacggaacc
acattcagctatgtctgtgatgatggcttcagaatatctaaggaaaatggggtaacctgc
cacatgggaaaatggagctctccgcctcgatgtgttgaatcaacagggaaatgtgggcct
cctccaactattgaaaatggagacatcacctccttgtcattaccagtatatgcaccgtta
tcatcagttgaatatcaatgccaatccttctataaaatgcagggcagcaagaaaataacc
tgcaaaaatggagagtgggaagagccaccaaaatgtttacatgcatgtgtattaacagaa
gaaattatgagaagacagaacataattcccaagaggacaaagaataaaaagatttatatc
cagtcaggggattatgttgaatttgtgtgtctaactgcatatcaaaaggcacaaggatca
cctgagtttcgtacacagtgcattgatggtcacatcaattatcccacctgctcaaaataa

DBGET integrated database retrieval system