KEGG   Rattus norvegicus (rat): 498276
Entry
498276            CDS       T01003                                 

Definition
(RefSeq) Fc gamma receptor II beta
  KO
K06472  low affinity immunoglobulin gamma Fc receptor II-a
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04380  Osteoclast differentiation
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno04666  Fc gamma R-mediated phagocytosis
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05150  Staphylococcus aureus infection
rno05152  Tuberculosis
rno05171  Coronavirus disease - COVID-19
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    498276
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    498276
   04613 Neutrophil extracellular trap formation
    498276
   04666 Fc gamma R-mediated phagocytosis
    498276
  09158 Development and regeneration
   04380 Osteoclast differentiation
    498276
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    498276
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    498276
   05150 Staphylococcus aureus infection
    498276
   05152 Tuberculosis
    498276
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    498276
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    498276
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    498276
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    498276
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    498276
CD molecules [BR:rno04090]
 Proteins
  498276
SSDB
Motif
Pfam: Ig_2 Ig_3 ig I-set Ig_4 Ig_5
Other DBs
NCBI-GeneID: 498276
NCBI-ProteinID: NP_001129464
RGD: 1594388
UniProt: P27645 B0K007
Position
13q24
AA seq 267 aa
MTLETQMFQNAHSGSQWLLPPLTMLLLFAFADRQTGDLLKAVVKRDPPWIQVLKDDTVTL
TCEGTHNPGNSSTQWFHNQSSTWGQVQASYTFKATVNDSGEYRCRMAHTSLSDPIHLEVI
SDWLLLQTPQLVFEEGETITLRCHSWKNKQLTKVLLFQNGKPVRYYYQSSNFSIPKANHS
HSGNYYCKAYLGRTMHVSKPVTITVQGSATASTSSLVWFHAAFCLVMCLLFAVDTGLYFC
VRRNLQTSGEDWRKSLSVGKYKAPQDK
NT seq 804 nt   +upstreamnt  +downstreamnt
atgactttggagacccagatgtttcagaatgcacattctggaagccaatggctactccca
ccactgacaatgttgctgctgtttgcttttgcagacaggcagacgggagatcttctgaag
gctgtggtgaaacgtgatcccccatggatccaggtgctcaaggacgacactgtgacgctg
acgtgcgaagggacccacaatcctggaaactcttctacccagtggttccacaaccagagc
tccacctggggccaggtccaagccagctacacgtttaaggccacagtcaatgacagtgga
gaataccggtgccgaatggcgcacaccagcctcagcgaccccatacatctggaagtgatt
tctgactggctgctgctccagacccctcaactggtgtttgaggaaggggaaaccatcaca
ttaaggtgccatagctggaagaacaaacagctgactaaggtcttgttgttccagaatgga
aaacctgtgaggtattattatcaaagcagcaatttttcaatccccaaagccaaccacagt
cacagtgggaactactactgcaaagcatatctaggaaggacaatgcatgtgtccaagcct
gtcaccatcactgtccaaggttcagcaaccgcgtccaccagctctctagtgtggttccat
gccgctttctgcctagtgatgtgcctcctgtttgcagtggacaccggcctgtatttctgt
gtacggagaaatcttcaaacctcgggggaggactggaggaaatccctgtcagtcggaaag
tacaaggctccacaggacaaatga

DBGET integrated database retrieval system