KEGG   Rattus norvegicus (rat): 498289
Entry
498289            CDS       T01003                                 

Gene name
Opn3
Definition
(RefSeq) opsin 3
  KO
K04256  c-opsin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    498289 (Opn3)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    498289 (Opn3)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     498289 (Opn3)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Vision
   Opsin
    498289 (Opn3)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 498289
NCBI-ProteinID: NP_001178862
RGD: 1594385
Ensembl: ENSRNOG00000003778
UniProt: D3ZFS1
Position
13q25
AA seq 400 aa
MYSGNRSGGQGYWEDGAGAEGAAPAGTRSPAPLFSPTAYERLALLLGCLALLGVGGNLLV
LLLYSKFPRLRTPTHLFLVNLSLGDLLVSLFGVTFTFASCLRNGWVWDAVGCAWDGFSGS
LFGFVSITTLTVLAYERYIRVVHARVINFSWAWRAITYIWLYSLAWAGAPLLGWNRYILD
VHGLGCTVDWKSKDANDSSFVLFLFLGCLVVPMGIIAHCYGHILYSVRMLRCVEDLQTIQ
VIKMLRYEKKVAKMCFLMAFVFLTCWMPYVVTRFLVVNGYGHLVTPTVSIVSYLFAKSST
VYNPVIYIFMIRKFRRSLLQLLCFRLLRCQRPAKNLPAAESEMQIRPIVMSQKDGDRPKK
KVTFNSSSIIFIITSDESLSVEDSDRSSASKVDVIQVRPL
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgtactcggggaaccgtagcggcggccagggctactgggaggacggggcgggcgccgag
ggcgcagcaccggccggcacgcggagccccgcgcctctcttcagccccaccgcgtacgag
cgcctggcgctgctgctcggttgcctcgcgctgctgggcgtcggcggcaacctgctggtg
ctgcttctctactccaagttcccgcgactgcgcacgcccacccacctcttcctggtcaac
ctcagtctgggcgatctgctggtatccctgttcggagtcaccttcaccttcgcgtcgtgc
ctgcggaacggctgggtgtgggacgccgtgggctgcgcgtgggacgggtttagcggcagc
ctctttgggtttgtttccattaccaccctcactgtgctggcttatgaacgttatatccgt
gtggtacatgccagagtgatcaatttttcctgggcctggagggccattacctatatctgg
ctctactctttggcatgggcaggagcgcctctcctgggctggaacaggtacatcctcgat
gtacatggactgggctgtactgtggactggaaatccaaggatgccaacgactcctccttt
gtgctcttcctgtttcttggctgtctggtggtgcccatgggcatcatagcccattgctac
ggtcatattctgtattctgttcgaatgcttcgctgtgttgaagatcttcagacaattcaa
gtgatcaagatgttgcgatacgaaaagaaagttgccaagatgtgctttttgatggccttt
gtctttctcacctgctggatgccttatgttgtaacccgcttcttggtggtcaatggctat
ggacacctggtcaccccaactgtgtctatcgtttcttatctctttgctaaatcgagcact
gtgtacaacccagttatctacatcttcatgatcagaaagtttcggaggtcccttctgcaa
ctcctctgtttccgcctgctgagatgccagaggcctgctaaaaacctcccagcagctgag
agtgaaatgcagatcaggcccattgtgatgtcacagaaagatggggacaggccaaagaag
aaagtgacatttaactcttcctccatcatcttcatcatcaccagtgatgagtccctgtca
gtcgaggacagcgacagaagcagcgcatctaaggtcgatgtaatccaagtgcgtccttta
tga

DBGET integrated database retrieval system