KEGG   Rattus norvegicus (rat): 498299
Entry
498299            CDS       T01003                                 

Gene name
Lefty1, RGD1561867
Definition
(RefSeq) left right determination factor 1
  KO
K04668  left-right determination factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04350  TGF-beta signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    498299 (Lefty1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    498299 (Lefty1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    498299 (Lefty1)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   498299 (Lefty1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 498299
NCBI-ProteinID: NP_001102550
RGD: 1561867
Ensembl: ENSRNOG00000003263
UniProt: D4A670
Position
13q26
AA seq 368 aa
MRFLWLCWALWALFQVSPGEALTGEQVLGSLLQQLRLDRPPVLDKADVEGMVIPSHVRAQ
YVALLQHSHDSRSRGKRFSQNFREVAGRFLVSETSSHLLVFGMEQRLPPNSELVQAVLRL
FQEPVPRTALRRQKRLSPHSARARVTIEWLRFREDGSNRTALIDSRLVSIHESGWKVFDV
TEAVNFWQQLSRPRQPLLLQVSVQREHLGPGTWSAHKLVRFAAQGTPDGKGLGEPQLELH
TLDLKDYGAQGNCDPETPVTEGTRCCRQEMYLDLQGMKWAENWILEPPGFLTYECVGSCL
QPPESLTIRWPFLGPRQCVASEMTSLPLIVSIKEDGRTRPQVVSLPNMRVQRCSCASDGA
LIPRRLEP
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgcggttcctatggctctgttgggcactctgggcactattccaggttagccctggagaa
gccctgactggagagcaggtcctgggcagccttctgcaacagctgcggcttgatcgaccg
ccagtcttggacaaggctgatgtggagggaatggtcatcccctcgcatgtgagggcccag
tatgtggccctgctccagcacagccatgacagccgctcccgaggcaagaggtttagccag
aactttcgagaggtggcaggcaggttcctggtgtcagagacctccagtcacctgctggtg
ttcggcatggagcagcggctgccgcctaacagtgagctggtgcaggctgtgctgcggctg
ttccaggagcctgtgcccagaacagctctccggaggcaaaagaggctgtccccacacagc
gcccgggctcgggtcaccattgaatggctgcgcttccgcgaggatggctccaaccgtacc
gcccttatcgattctaggctcgtgtccatccacgagagcggctggaaggtcttcgatgtg
accgaggccgtgaacttctggcagcagctgagccggccgaggcagccgctgctgctccag
gtgtcggtgcagagggagcatctgggaccggggacctggagcgcacacaagttggtccgg
ttcgcggcgcaggggacgccggacggcaaggggctgggcgagccacagctggagctgcac
acgctggacctcaaggactatggggctcaaggcaattgtgaccccgagacaccagtgact
gaaggcacccgatgctgtcgccaagagatgtacctggacctgcaggggatgaagtgggct
gagaactggatcctagaacccccaggattcctgacttacgaatgtgtgggcagctgcctg
cagccaccagagtccctgaccatcaggtggccatttctggggcctcggcagtgtgtggcc
tcagagatgacttccttgcccctgattgtcagcataaaggaggacggcaggaccaggcct
caagtggtcagcctgcccaacatgagggtgcagaggtgtagctgtgcctcggatggggcg
ctcatacccaggaggctggagccatag

DBGET integrated database retrieval system