KEGG   Rattus norvegicus (rat): 498310
Entry
498310            CDS       T01003                                 

Gene name
Nsl1, RGD1562052
Definition
(RefSeq) NSL1, MIS12 kinetochore complex component
  KO
K11545  kinetochore-associated protein NSL1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    498310 (Nsl1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    KMN network proteins
     MIS12 complex
      498310 (Nsl1)
SSDB
Motif
Pfam: Mis14
Other DBs
NCBI-GeneID: 498310
NCBI-ProteinID: NP_001102553
RGD: 1562052
Ensembl: ENSRNOG00000042286
UniProt: F1M3N2
Position
13q27
AA seq 281 aa
MAGVPETVLVSAPQDQDAQAALDSQATAAASPLEDFRVRCTLKRAVVEVMEMCGRFVQEL
GAALPEDVRELAVRDAQWTFESAVQENVSINGQVWEEATDHCFMDSDIKVLEDEFDELIV
DVSTKRRQYPRRILESIVKTLKAQHASLKQYHPVVPPLDLKCDPDPASHVEDLKCRGETI
AKEMSEAMKALPVLIEQGDGFSQVLKMQPVIQLQRISQEVFSSLCRRADFKPDKCGTHVE
STPTETGARKASNIVLKRKKATDCAQRKCYPLRLKRINLDM
NT seq 846 nt   +upstreamnt  +downstreamnt
atggcgggtgttcctgaaacagtacttgtctccgccccgcaggatcaagatgcccaggcc
gccttagattcccaggccacggcagcagcctctcccctagaggacttccgagtgcgctgc
accttaaagagggccgtggtggaagtgatggagatgtgcggtcgttttgtgcaggagctc
ggggccgcgctgccggaggacgtccgcgagctcgccgtgcgggacgcgcagtggactttt
gagtcggctgtgcaggagaatgtcagcattaacggacaggtctgggaggaagctacagat
cattgttttatggattctgacatcaaagtgcttgaagatgaatttgatgagctcatagta
gatgtgtcgacaaaacggaggcagtatcccagaaggatcctggagagcattgtcaaaacc
ttgaaagcacagcatgcgagtctgaagcagtatcaccctgtcgtgcctcccctggacctg
aaatgtgaccctgacccagcttctcatgtggaagatctgaaatgccgtggagaaaccata
gctaaggaaatgagtgaggccatgaaggctttgcctgtgttaattgaacaaggagacggc
ttttcccaggtcttaaagatgcagcctgtcatccaactgcagaggatcagccaggaagtc
ttctccagcctttgcaggagagcagatttcaagcctgacaagtgtgggacacacgtagaa
tccacaccaactgagactggagccaggaaggcctccaacattgtgctaaagagaaagaaa
gccacagactgcgcccagagaaagtgctacccactgcggctgaagagaataaatctcgat
atgtga

DBGET integrated database retrieval system