KEGG   Rattus norvegicus (rat): 498333
Entry
498333            CDS       T01003                                 

Gene name
Bmp2k
Definition
(RefSeq) BMP-2 inducible kinase
  KO
K08854  BMP2 inducible kinase [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    498333 (Bmp2k)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    498333 (Bmp2k)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     498333 (Bmp2k)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  NAK family [OT]
   498333 (Bmp2k)
SSDB
Motif
Pfam: BMP2K_C Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH
Other DBs
NCBI-GeneID: 498333
NCBI-ProteinID: XP_008762868
RGD: 1564828
Position
14p22
AA seq 1093 aa
MKKFSRMPKSEGSGGGAAAGGAAGSGLGGGFGSSSMGVRVFAVGRYQVTLEESLAEGGFS
TVFLVRTHSGIRCALKRMYVNNTPDLNICKREITIMKELSGHKNIVGYLDCAVNSISDNV
WEVLILMEYCRAGQVVNQMNKKLQTGFTESEVLQIFCDTCEAVARLHQCKTPIIHRDLKV
ENILLNDAGNYVLCDFGSATNKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLYGGKPI
TTKADIWALGCLLYKLCFFALPFGESQVAICDGSFTIPDNSRYSHNVHCLIRFMLEPDPE
HRPDIFQVSYFAFKFAKKDCPVSNINNSILPSTLPEPMTATEAAARKSQMKARITDTIGP
TETSIAPRQRPKANSTIGALRPGNGSDILMVQGPTQQPPQQHRVLQQLQQGDWRLQQLHL
HRHPQQQQQQQQQQQQQQQQQQQQQQLLQNAYLQQYQHAMHQQQILQQQFLMHSVYQPQP
LASQYPTMMQQYQQALLQQQMLAHHQQPAQQVSPEYLTSPQEFSPALAPYGSSLPAQVGT
IVDSSYGATSRSVAEKEAVANFTNQKTISHPPDMSGWNPFGEDNFSKLTEEELLDREFDL
LRSNRLGESTPSDKNVDPPPAPHSRPPEEPFASVPFISHSGSPEKKTEHSPNQKNITAHP
TKNGSSSPICKAGQKTSENPVVRGHAQKGNDESESEFESDPPSPKSSEEEQEDEDAQGEH
GDFNDEDTEPENLGHRPLLMDSEDEEEDDKHSSDSECEQAKAKGGESSSLRRNKPGGAPE
PASSPALTPSQEFDVFGAVPFFAVPAPELQHRGSGKSVSQQMFPEQEEYDVFTKAPFSKK
VTVQDWPAVRPDTRPLPARPRSVDIFGSTPFQPFSTAASKSESKEDVFGLVPFEEITGSQ
QQQQKVKQRSLQKLSSRQRRTKQDVSKSNGKRHHGTPTSAKKPLKPPYRTPERARRHKRV
GRRDSQSSNEFLTISDSKENISVALTDGKDRASVLPPDESLLDPFGAKPFHPPDLWHQTH
QGLSDICVDHTAILPGRPRQNSVHGSFHSADALRMDDFGAVPFTELVVQSVSPQQSQPVE
LDPFGAAPFPSKQ
NT seq 3282 nt   +upstreamnt  +downstreamnt
atgaagaagttctctcggatgcccaagtcggagggcagcggcggcggggcggcggctgga
ggggccgcgggctccgggctcggcggcggcttcggaagctcgtccatgggggtccgggtg
ttcgccgtcggccgctatcaggtcaccctggaggagtcgctggccgaaggcggcttctcc
actgttttcctggtgcggactcacagtgggatccgatgcgcactgaagcgaatgtacgtc
aataacacacctgacctcaacatctgtaaaagggaaatcacaattatgaaagagctatct
ggccacaaaaatattgttggttatttggactgtgctgtcaattcaattagtgataatgta
tgggaagtgctcatcctaatggaatattgtcgagctgggcaggtcgtgaaccagatgaat
aagaagctgcagacaggctttaccgagtctgaagtcctacagatcttctgtgacacctgt
gaagcagtcgcacggttgcatcaatgtaagactcccataatccaccgggatctgaaggta
gaaaatattttgttaaatgatgctgggaattacgtgctttgtgactttggcagtgccact
aataaatttctcaatcctcaaaaagatggagttaatgtagtagaagaagaaattaaaaaa
tacacgactctgtcatatagagccccagaaatgatcaacctttatggagggaaaccgatc
accaccaaggctgatatctgggccctgggatgtttgctgtataaactttgtttcttcgct
cttccttttggtgagagtcaggttgctatctgtgacggcagcttcaccatcccagataat
tctcgctactcccataacgttcattgtttgattaggttcatgcttgaaccagaccccgag
cacagacctgacatatttcaagtctcctactttgcatttaaatttgccaaaaaggattgt
ccggtctccaacatcaataattccattcttccatcaactcttccagaaccgatgactgct
accgaagccgctgctaggaaaagccagatgaaagccagaataacagataccattggacca
acagaaacctcaattgcaccaagacaaagaccaaaggccaattccaccataggagcactg
agacctggaaatgggtctgacatcttaatggttcagggacccactcagcagccaccacag
cagcatagagttctccagcaattacagcagggagattggagattacagcagcttcatttg
catcgtcatccccagcagcagcagcagcagcagcagcagcagcagcagcagcaacagcag
caacagcagcagcagcaactacttcaaaacgcttatttgcagcagtatcaacatgcaatg
caccagcaacaaatacttcaacaacagtttttaatgcactcagtgtatcagccacaacct
cttgcatctcagtatccgaccatgatgcagcagtatcagcaggctctcttgcagcagcag
atgctagctcaccatcagcagccagcgcagcaggtgtcacctgagtatcttacctctcct
caagagttctcaccagccttagctccctacggctcttcacttccagctcaggttggaacc
atagtggactcctcttatggtgccaccagcaggtcagtcgctgagaaagaggcagttgca
aatttcacaaatcagaagaccatcagtcacccccctgacatgtcagggtggaatcctttt
ggagaagacaatttttccaagttaacagaagaggaactgttggacagagaatttgacctc
ctaagatcaaacaggctcggggagagcacaccctcagataagaatgtagacccgccccct
gctccacatagccgtcctccggaggagccttttgcttccgtccctttcatttctcactca
ggttctcctgaaaagaaaacggaacattctccaaaccagaaaaatatcactgcacaccca
accaaaaatggaagctcaagtccgatatgtaaagctggacagaaaacctcagagaatcct
gtagttaggggtcacgcacagaagggaaatgacgagtctgaaagtgaatttgaatcagac
cccccttctcccaagagcagtgaagaagaacaagaggatgaagacgcacagggagaacac
ggggactttaatgatgaggacactgagccagagaacctgggtcacaggcctctgctcatg
gactccgaagatgaggaggaggacgacaaacacagctctgactcggagtgtgaacaggca
aaagccaagggaggagaatcgagctccttgcgcagaaacaaacctggtggtgccccggag
cctgccagttcacccgcgctgactcccagtcaggagttcgatgtgttcggtgctgttccc
ttctttgcagtgcctgctccagagctgcagcacagagggagtgggaagagcgtctcccag
cagatgtttccagagcaggaggaatatgacgtgttcacaaaggcacccttcagcaagaag
gtcaccgtacaggactggcccgccgtgcggccagacactcgccccctgcctgcacgaccc
agaagtgtagacatatttggctccactccctttcagccattttccacagcagccagtaaa
agtgaaagcaaggaggatgtttttgggctcgtgccctttgaggaaataaccgggagtcag
cagcagcagcaaaaagtcaagcagcgtagcttgcagaaactgtcctctcgccagaggcgc
acgaagcaggatgtgtcgaaaagcaacgggaagcggcatcacggcacacccaccagcgcc
aagaagcccctgaagcctccctaccgcacacccgagagggcccgcaggcacaagagggtg
ggccgcagagactcacaaagcagcaatgagttcttaacaatttcggactccaaggagaac
atcagcgtcgcgctgaccgatggcaaagacagggccagcgtcctgccacccgatgagagt
ctgctggacccttttggtgccaagccttttcatcctccagacttgtggcaccagacccat
cagggcctaagcgacatctgtgtggatcacaccgccattctgcctgggagaccacgacag
aattcagtacatgggtcattccacagcgcagacgcattgagaatggatgactttggtgcc
gtgccctttacagaactcgtggtgcagagcgtctctccgcagcagtcccagccggtggaa
ttagaccccttcggtgctgctccattcccttctaaacagtag

DBGET integrated database retrieval system