KEGG   Rattus norvegicus (rat): 498351
Entry
498351            CDS       T01003                                 

Gene name
Srp72
Definition
(RefSeq) signal recognition particle subunit SRP72
  KO
K03108  signal recognition particle subunit SRP72
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03060  Protein export
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    498351 (Srp72)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rno02044]
    498351 (Srp72)
Secretion system [BR:rno02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   498351 (Srp72)
SSDB
Motif
Pfam: TPR_19 SRP72 SRP_TPR_like ANAPC3 TPR_14 TPR_2 TPR_12 TPR_8 TPR_6 TPR_9 TPR_1 HrpB1_HrpK BTAD SNAP TPR_11 TPR_MalT TPR_10 DUF627 CorA DUF3805 CCDC-167 TPR_3
Other DBs
NCBI-GeneID: 498351
NCBI-ProteinID: NP_001164072
RGD: 1564787
Position
14
AA seq 671 aa
MASGGSGGVSVPALWSEVNRYGQNSDFTRALKTVNKILQINKDDVTALHCKVVCLIQNGS
FKEALNVINTHTKVLANNSLSFEKAYCEYRLNRIENALKTIESANQQTDKLKELYGQVLY
RLERYDECLAVYRDLVRNSQDDYDEERKTNLSAVVAAQSNWEKVVPENLGLQEGTHELCY
NAACALIGQGQLTQAMKILQKAEDLCRRSFSEDSDGTEEDPQAELAIIHGQMAYIMQLQG
RIEEALQLYNQIIKLKPTDVALLAVIANNIITINKDQNVFDSKKKVKLTNAEGVEFKLSK
RQLQAIEFNKALLAMYTNQAEQCRKIASSLQSQSPEHLLPVLIQAAQLCREKQHTKAIEL
LQEFSDQHPENAAEIKLTMAQLKISQGNISKACLILRSIEELKHKPGMVSALVTMYSHEE
DIDSAIEVFTQAIQWYQSHQPKSPAHLSLIREAANFKLKYGRKKEAVSDLEQLWKQNSKD
IHTLAQLISAYSLVDPEKAKALSKHLPSSDSMSLKVDVEALENSPGATYIRKKGGKVTGD
NQPKEQGQGDLKKKKKKKKGKLPKNYDPKVTPDPERWLPMRERSYYRGRKKGKKKDQIGK
GTQGATAGASSELDASKTVSSPPTSPRPGSAATMASSTSNIVPPRHQKPAGAPATKKKQQ
QKKKKGGKSGW
NT seq 2016 nt   +upstreamnt  +downstreamnt
atggcgagcggcggcagcggtggggtgtcagtccctgcgctgtggagtgaggtgaaccgt
tatgggcagaacagcgacttcacgcgtgccctcaagaccgtcaacaaaatattgcagatc
aacaaggatgatgtcacggccttgcactgtaaagttgtttgccttatccagaatggaagt
ttcaaagaagccttgaatgtcatcaatactcacaccaaagtgttagccaataactctctg
tcctttgagaaggcatattgcgagtacaggttgaacagaatcgagaatgccttgaagaca
atagaaagtgccaaccagcagacagacaaactgaaggagctttatggacaagtgctgtac
cgcctggaacgctacgatgagtgcctggccgtgtaccgagatcttgtccgaaactcccag
gatgactacgatgaggagaggaagacaaacctgtcagcagtcgttgccgctcaaagcaac
tgggaaaaagtggttcccgagaacttgggtctccaagaaggcacacacgaactctgttac
aacgctgcgtgtgcactgatagggcaaggccagctgacccaggcaatgaaaatcctacaa
aaggctgaagatctttgtcgccgttcattttcagaagattcagacgggactgaggaagac
cctcaggccgagctggccatcattcacggtcaaatggcttacatcatgcagcttcagggg
cgcatcgaggaggctctgcagctttacaatcagataataaaactgaagccaacagatgtg
gcacttcttgctgtaatcgcaaataacatcatcaccattaataaggaccaaaatgtcttt
gactccaagaagaaagtgaaattaaccaatgcagaaggagtagagtttaagctctccaag
agacagcttcaagccatagagttcaacaaggctttgcttgccatgtatacaaaccaggca
gaacagtgccgaaaaatagcttctagcttgcagtcccagagtcctgagcatctcctgcct
gtgctgatccaagctgcccagctctgtcgtgaaaagcagcatacaaaggcaatagagctg
cttcaggaattttctgatcaacatccagaaaatgcagctgaaatcaagcttaccatggct
caattgaaaatttcccaaggtaatatttccaaagcgtgcctaatactgagaagcatagag
gagttaaagcataagccaggcatggtatccgcgttggtgaccatgtacagccatgaggaa
gacattgatagtgccattgaagtcttcacacaggctatccagtggtatcaaagccatcag
cccaagtcccctgctcatttgtccttgataagagaggccgcaaacttcaagctcaaatat
ggacggaagaaggaggcagttagtgacctagagcagctgtggaaacaaaattcaaaagat
attcacacgctagcccagcttatctctgcttactcacttgtggatccagagaaagcaaag
gctcttagtaaacacctgccctcatcggatagtatgtctctaaaggtagatgttgaggct
cttgagaattctcctggtgctacgtacattcggaagaagggtggaaaagttactggagat
aatcaaccaaaggaacaaggacagggagatttgaagaagaagaagaagaaaaagaaagga
aaactgcctaagaattatgacccaaaagttaccccagatccagaaagatggctaccaatg
cgagagcgctcttactaccgaggaagaaagaagggcaaaaagaaggaccagatcggaaaa
ggaacacagggagcgaccgcaggagcctcctctgagctggacgccagtaaaactgtgagc
agcccacccacctccccaagacctggcagtgcggcaacgatggcctcctctacaagtaac
attgtacccccaagacaccagaaacccgcaggggccccagcaacgaaaaagaagcagcaa
cagaagaagaagaaaggagggaaaagtggttggtga

DBGET integrated database retrieval system