KEGG   Rattus norvegicus (rat): 498411
Entry
498411            CDS       T01003                                 

Gene name
Hus1
Definition
(RefSeq) HUS1 checkpoint clamp component
  KO
K10903  HUS1 checkpoint protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    498411 (Hus1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    498411 (Hus1)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  Check point factors
   Rad9-Hus1-Rad1 complex
    498411 (Hus1)
SSDB
Motif
Pfam: Hus1
Other DBs
NCBI-GeneID: 498411
NCBI-ProteinID: NP_001102562
RGD: 1591976
Ensembl: ENSRNOG00000005141
UniProt: D3ZNA8
Position
14q21
AA seq 280 aa
MKFRAKIVDLACLNHFTRVSNMIAKLAKTCTLRISPEKLNFILCDKLASGGVSMWCELEQ
ENFFSEFQMEGVSEENNEIYLELTSENLARALKTAQNARALKIKLTNKHFPCLTVSVELL
SSSSSSRIVVHDIPIKVIPRRLWKDLQEPSIPESDVSIYLPALKTMKSVVDKMRNISNHL
VIEANLKGELNLKIETESVCVTTHFKDLENPLLPSDSVSQNRHPEDMAKVHIDIRKLLQL
LAGQQVAPTKAVCNIVNNRTIHFDLLLEDVSLQYFIPALS
NT seq 843 nt   +upstreamnt  +downstreamnt
atgaagtttcgtgccaagatcgtggatctggcttgtctgaatcactttacacgagtcagt
aacatgatagccaagcttgccaaaacctgcaccctccgcatcagcccagagaagctgaac
ttcatcctctgtgacaagctggccagtggaggcgtgagcatgtggtgtgagctggagcag
gagaacttttttagtgaattccaaatggaaggagtctctgaagaaaacaatgagatttat
ttagaattaacgtcggaaaacttagctcgagccttgaagactgcccagaacgccagagcc
ttgaaaatcaagcttactaacaagcactttccctgtctaaccgtgtccgtagagctgttg
tcttcatcaagcagtagcagaattgtggtacatgatatccccataaaggttattccgaga
agactgtggaaggacttacaagaaccctccatcccagaatctgatgtcagtatttatcta
ccagccttgaagacaatgaagagtgtcgtggataaaatgaggaacatcagcaatcacctt
gttattgaagcaaacctaaaaggagaactaaacctaaagatagaaactgagtcagtatgt
gtgacaacacactttaaggatcttgaaaaccctctactaccttctgacagtgtctctcaa
aacagacacccagaagacatggccaaggtgcacatcgacataaggaaactcctccagttg
cttgctggacagcaagtggctcccaccaaggcggtgtgcaatatcgtcaataacagaact
attcactttgatctgctcctggaagacgtctcccttcagtatttcatcccagccttgtcc
tag

DBGET integrated database retrieval system