KEGG   Rattus norvegicus (rat): 498412Help
Entry
498412            CDS       T01003                                 

Gene name
Sun3, Sunc1
Definition
(RefSeq) Sad1 and UNC84 domain containing 3
  KO
K21874  SUN domain-containing protein 3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    498412 (Sun3)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   LINC complex
    498412 (Sun3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sad1_UNC
Motif
Other DBs
NCBI-GeneID: 498412
NCBI-ProteinID: XP_006221904
RGD: 1591975
Ensembl: ENSRNOG00000005105
Position
14q21
AA seq 411 aa AA seqDB search
MVWCGEQVRVRKRKVLLSPGSLGAADRLARWEQRLQGQSQRARGSTRLQLTHLQTPYAQE
LARPLRSHGSTVSTLNTQEEHMRQNIQPERIQLTGSWKIILSTVFASTFLLVGLLNHQWL
KETEFPQKPRQLYTVIAEYGSRLHNYQARLRMPKEQQELLKKESQTLENNFREILFLIEQ
IDLLKALLRDMKDGVHNHSWPAQREAVQDQATAEVLDEEMSNLVHYVLKKFRGDQIQLAD
YALKSAGASVIEAGTSESYKNNKAKLYWHGIGFLNYEMPPDMILQPDVHPGKCWAFPGSQ
GHILIKLARKIIPTAVTMEHISEKVSPSGNISSAPKEFSVYGVTKKCEGEEMFLGQFIYK
KMEATIQTFELQNEASESLLCVKLQILSNWGHPKYTCLYRFRVHGIPSDHT
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggtctggtgcggtgagcaagtccgcgtccggaagagaaaggtgctgctaagccctggt
tctctgggagccgccgaccgactggcccgatgggagcagaggctgcaggggcaaagtcag
cgcgctcgtggttccacccgcctccagctgacacacctgcagacgccttacgcccaggag
ctggcacggccactgcgctcacacggcagcacggtgtccacgctgaacacccaggaggag
cacatgcgccagaatatacagccagagcgcattcagttaactggatcatggaagattatc
ctaagtacagtgtttgcatcaacttttcttcttgttggacttctaaatcatcagtggctt
aaagaaacagagtttcctcaaaaacccagacaattatacactgtcattgcagaatatggc
tcccggctccacaattaccaggccagacttcgcatgcctaaggagcaacaggaactttta
aagaaggaaagccagactttggagaacaattttcgtgaaattctgtttttaattgaacaa
atagatcttctgaaggcgttgcttagagacatgaaggacggcgtacacaatcacagctgg
cctgcccaacgagaagctgtgcaggaccaggccactgctgaagttctagatgaggaaatg
tcaaacttggtacattatgtacttaaaaagttcagaggggaccaaatacagctggctgat
tatgccctgaagtcagctggagcctctgtcattgaagctgggacttcagagagttacaaa
aataataaagcaaaactgtactggcatgggatagggttcctcaactatgagatgcctccg
gatatgattcttcagccagatgtccaccctggaaagtgctgggcctttccgggttcccag
ggtcacatcctgattaagctggccaggaagatcatcccaacagcagttaccatggagcac
atctcggagaaggtgtccccttcaggaaacatctcgagtgcaccgaaggagttctctgtc
tatggtgttaccaagaagtgtgagggagaagaaatgttcctaggtcagtttatttataag
aagatggaagcgaccattcaaacatttgagctccagaatgaagcttctgaatctttgcta
tgtgtgaaacttcagattcttagcaactggggacatccaaagtatacttgtttgtaccga
tttagagtccatggcatccccagtgatcacacttag

DBGET integrated database retrieval system