KEGG   Rattus norvegicus (rat): 498415
Entry
498415            CDS       T01003                                 

Gene name
Zpbp
Definition
(RefSeq) zona pellucida binding protein
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Sp38 Ig_3 ig I-set
Other DBs
NCBI-GeneID: 498415
NCBI-ProteinID: NP_001020310
RGD: 1563985
Ensembl: ENSRNOG00000027801
UniProt: Q6AXU2
Position
14q21
AA seq 409 aa
MCTQEGSQARTPPADHPSGSGGVSVGPSFRPAVRQLPAAGGRAPGNDLLRRGSAVGGVWM
EALAPGPALRGRRRARASGSVLSALSLAAVVLSALLRAPPAVGHLARVPRGFRLTQDTLK
IVGSTHFPVSVYVMLHQKSPHVLCVTQRLRNTELVDPSFQWHGPKGKLVSENTTAQVTST
GSLIFQSFEETMSGVYTCFLEYKPTVEEPIKNLQLKYIVYAYREPRFYYQFTARYHAAPC
NSIYNISFEKKLLQILSKLVLDLSCEISLIKSECHRVKMQRAGLQNELFFTFSVASIDTE
KGSKPCTDHSCEASKRLSKAKNLIERFFIQQVEVLGKRAEPLPEIYYIEGTLQMVWVNRC
FPGYGINILKHPKCPECCVVCSPGSFNPRDGTHCLQCNNSVVYGAKTCM
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgtgtacccaagaggggtcccaagctaggacacctcccgcagatcacccgagcggaagt
ggcggcgtgtccgtcggtccgtccttccggcccgccgtccgccaacttccggcggcgggt
gggcgcgcgccaggtaacgaccttctgcgccgaggctcggccgtcggcggcgtgtggatg
gaggccttggccccgggcccggctctgcggggccggcggcgggccagggcctcgggctcc
gtgctctcggcgctgtcgctggccgccgtcgtgctctccgccttgttgcgggcgccccct
gcagttggacatttggctcgagtgccaagaggttttcgcttgactcaagatacgctgaaa
atagtgggatcaacacattttcctgtgagcgtatatgtcatgcttcatcaaaagagtcca
catgtgctatgtgtaacccagcgactgagaaatactgagttggtagacccatcgttccaa
tggcatgggccgaagggaaaacttgtttcagaaaataccaccgcacaagtgacatccaca
ggaagcctcatatttcagagttttgaagagaccatgagtggggtttatacatgttttctc
gagtataaaccaactgtggaggaacctattaaaaatcttcaactgaaatacattgtttat
gcttatcgtgaacctcgtttttattaccaattcacagcccgataccatgcagctccctgc
aatagtatctataacatttcttttgagaagaaacttcttcagattttaagtaaactggtt
cttgacctttcctgtgaaatttccttgattaagtctgaatgccatcgtgttaaaatgcaa
agagctggtttgcaaaacgaattattcttcacattttcagttgcatctatagacactgaa
aaaggatccaagccatgtacagaccatagttgtgaagcttccaaaagattatctaaggct
aaaaatctcatagagaggttcttcattcagcaagtggaagtcctgggcaagcgtgcggag
ccgctgcctgagatatattacattgaggggacccttcagatggtgtgggtgaaccgctgc
tttccagggtatggcataaacatcctgaagcatcccaagtgtcctgagtgctgtgtggtc
tgcagccctggatccttcaatccccgggatggaactcactgcctccaatgcaacaacagc
gtggtgtatggagcgaagacatgcatgtag

DBGET integrated database retrieval system