KEGG   Rattus norvegicus (rat): 498425Help
Entry
498425            CDS       T01003                                 

Gene name
Zrsr1
Definition
(RefSeq) zinc finger (CCCH type), RNA binding motif and serine/arginine rich 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-CCCH RRM_1 zf-CCCH_4 zf_CCCH_4 Torus
Motif
Other DBs
NCBI-GeneID: 498425
NCBI-ProteinID: NP_001017504
RGD: 1561824
Ensembl: ENSRNOG00000009639
UniProt: Q5RK33
Position
14q22
AA seq 428 aa AA seqDB search
MASQQTAFPEKLSRKQYKAAMKKEKRKKRRQKMARLRALEAPPEVEEEDVSANEELAERL
LEIERQKLHEEWLLREEKAQEEFRIKKKKEEAARKQKEEQERQIKAEWEEQQKKQREEEE
QKLQEKKEREEAVQKMLDQAENEGTWQNPEPPKDLRLEKYRPSCPFYNKTGACRFGNRCS
RKHDFPTSSPTLLVKSMFTTFGMEQCRRDDYDSDANLEYSEEETYQQFLDFYHDVLPEFK
NVGKVIQFKVSCNLEPHLRGNVYVQYQSEEECQAALSLFNGRWYAGRQLQCEFCPVTRWK
VAICGLFEMQKCPKGKHCNFLHVFRNPNNEFRDANRDIYLPPASTGSSGKNSDRGDRKDH
REESYSKSRSHHSGSYHSSKRSRESERKSPHRWKKSHKQATKSHERHSSRRGREEGSSPG
PQSQSHRT
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggcatcacagcagaccgcgtttcctgagaaactcagcagaaaacaatacaaggctgca
atgaagaaggagaaacgcaagaaacgtcggcagaaaatggctcgcttgagagctctggaa
gccccaccagaggtggaggaggaggatgtttctgccaatgaagaacttgcagagagatta
ctggagatagagaggcaaaaattacatgaagagtggctgctgagggaggagaaggcacaa
gaagaattcagaataaagaagaaaaaggaggaggctgctagaaaacagaaggaagaacag
gagagacaaataaaggctgaatgggaagaacaacagaaaaaacagagagaggaggaggag
cagaagctacaggagaagaaagagagagaggaagcggtgcagaaaatgctggaccaggct
gaaaatgaaggcacttggcagaacccagaaccacccaaagatttaaggctggagaaatat
cgacccagttgtcccttctacaataagacgggagcctgcagatttggtaacaggtgttca
cggaagcatgactttcccacgtcaagtcccacacttcttgtgaagagtatgtttacgacg
tttggaatggagcagtgcagaagggatgactacgactctgacgcaaacctggagtacagt
gaggaggagacctaccagcagtttttggatttctaccacgacgtgctgcccgagttcaag
aacgtgggaaaggtgattcagttcaaagtaagctgcaatctggaacctcatttgcggggc
aatgtgtatgttcagtaccagtcggaagaggaatgccaagcagccctctctctctttaat
ggaagatggtacgcaggacgacagctgcagtgtgaattctgtccagtgacccggtggaag
gttgcgatttgcggtttgttcgaaatgcaaaagtgtccgaaaggaaagcactgcaacttc
ctccatgtgttcagaaaccccaacaacgagttcagagacgcgaacagggacatctacctg
cctccggcgagcactggctcctctggtaaaaactcagaccggggggacaggaaggatcac
cgagaggaaagctacagcaagtcaagaagccaccactctggctcataccactcctccaag
agaagcagggagtcggagaggaagagtcctcacaggtggaagaaatctcacaaacaggcc
acgaagagtcatgagcggcacagctcaagaagaggaagagaagagggcagcagtccaggt
ccgcaaagccagagccacagaacctga

DBGET integrated database retrieval system