KEGG   Rattus norvegicus (rat): 498440
Entry
498440            CDS       T01003                                 

Gene name
Myoz1, RGD1561064
Definition
(RefSeq) myozenin 1
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Calsarcin
Other DBs
NCBI-GeneID: 498440
NCBI-ProteinID: NP_001102567
RGD: 1561064
Ensembl: ENSRNOG00000040122
UniProt: D4A7U8
Position
15p16
AA seq 296 aa
MPLSGTPAPNKRRKSSKLIMELTGGGRESSGLNLGKKISVPRDVMLEELSLLTNRGSKMF
KLRQMRVEKFIYENHPDVFSDSSMDHFQKFLPTVGGQLESAGQGFSYGKGSSGGQAGASG
SAGQYGSDRHQQGSGFGAGGAGGPGGQAGGGAAPGTVGVGEPGSGDQAGGDGKHVTVFKT
YISPWDRAMGVDPQQKVELGIDLLAYGAKAELPKYKSFNRTAMPYGGYEKASKRMTFQMP
KFDLGPLLSEPLVLYNQNLSNRPSFNRTPIPWLSSGEHVDYSVDIGIPLDGETEEL
NT seq 891 nt   +upstreamnt  +downstreamnt
atgccgctctcgggaaccccggcccctaacaagaggaggaagtcaagcaaactgattatg
gagctcactggaggcggtcgggagagttcgggcctgaacctgggcaagaagatcagtgtc
ccgagggatgtgatgttggaggagttgtcgctccttaccaaccgaggctccaagatgttc
aagctgcggcagatgcgggtggagaaatttatctatgaaaaccaccccgatgttttctct
gacagctcaatggatcacttccagaagtttcttcccacagtgggaggacagctggagtca
gctggtcagggcttctcctatggcaagggcagcagcggaggccaggctggggccagtggc
tctgctggacagtatggctctgaccgccatcagcagggctctgggtttggagctgggggt
gcaggtggtcctgggggccaggctggcggaggagcagctcccggcacagtaggggttgga
gagccaggatcaggtgaccaggcaggtggagatgggaaacacgtcactgtgttcaagaca
tatatttccccgtgggatcgggccatgggggtcgaccctcagcaaaaagtggaacttggc
attgacctgctggcatatggcgccaaagctgaactccccaagtataagtcctttaacagg
acggcaatgccctatggtggatatgagaaggcctccaaacgaatgaccttccagatgccc
aagtttgacctggggcctctgctgagtgaacccttggtcctctacaaccagaacctctcc
aacaggccttctttcaatcgaacccctattccctggttgagctctggggagcatgtagac
tacagcgtggatatcggcatacccttggatggagagacagaggagctgtga

DBGET integrated database retrieval system