KEGG   Rattus norvegicus (rat): 498475Help
Entry
498475            CDS       T01003                                 

Gene name
Ptgdr, RGD1565108
Definition
(RefSeq) prostaglandin D2 receptor-like
  KO
K04332  prostaglandin D2 receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    498475 (Ptgdr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    498475 (Ptgdr)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    498475 (Ptgdr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 ResB
Motif
Other DBs
NCBI-GeneID: 498475
NCBI-ProteinID: NP_001128636
RGD: 1565108
Ensembl: ENSRNOG00000031535
UniProt: Q9R261
Position
15p14
AA seq 357 aa AA seqDB search
MNESYRCQAATWVERGSSATMGGVAFSAGLLGNLLALVLLARSGLGSCRPGPLHPPPSVF
YVLVCGLTVTDLLGKCLISPMVLAAYAQNRSLKELLPASGNQLCEAFAFLMSFFGLASTL
QLLAMALECWLSLGHPFFYQRHITARRGVLVAPVAGAFSLAFCALPFAGFGKFVQYCPGT
WCFIQMIHKKRSFSVIGFSVLYSSLMALLVLATVVCNLGAMSNLYAMHRRQRHHPRRCSR
DRAQSGSDYRHGSPNPLEELDHFVLLALTTVLFTMCSLPLIYRAYYGAFKLVDRADGDSE
DLQALRFLSVISIVDPWIFIIFRTSVFRMLFHKTFTRPLIYRNWCSHSWQTNMESTL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagtcctatcgctgtcaggcagccacctgggtggaacggggctcctcagcgaca
atgggtggtgtggctttcagtgcaggactgctgggcaacctcctggcgctggtgctgctg
gcgcgatccgggctggggtcctgccggccagggccactgcatccgccgccctcggtcttt
tacgtgctagtgtgcggcttgacagtcaccgacttgctgggcaagtgtctgatcagcccg
atggtcctggctgcatacgcgcaaaatcggagcctaaaggaactgctgcctgcctcaggc
aaccagttatgtgaagccttcgccttcctgatgtccttctttgggttagcctcgacctta
cagctactggctatggcactagagtgctggctgtctctgggacaccctttcttctaccaa
aggcacatcaccgcccgccggggagtgctggtggcaccagtcgcgggcgccttctctttg
gctttctgtgcgctcccctttgctggctttgggaagttcgtccagtactgtccgggtacc
tggtgcttcatccagatgatccacaagaagcgctcattctcggtaataggcttctctgtg
ctctactccagcctcatggcgctgctggtcctcgcaactgtggtgtgcaacctgggtgcc
atgtccaacctctatgccatgcacaggcgccagaggcaccatccccgccgctgctccagg
gaccgcgcccagtcaggctcagactacaggcatgggtccccgaatcctttggaggagctg
gaccactttgttctgctggctctcacgacagtgctcttcaccatgtgttccctgccttta
atttatcgtgcttactatggagcctttaaacttgtggacagagctgacggagactcggaa
gacctccaagccttgcgttttctgtctgtgatttccatcgtggacccctggatcttcatc
attttcaggacttcagtattccggatgttatttcacaagactttcacaagacctctgatc
tacagaaactggtgcagccattcctggcagactaacatggaatccactttgtga

DBGET integrated database retrieval system