KEGG   Rattus norvegicus (rat): 498533
Entry
498533            CDS       T01003                                 

Gene name
Fam167a, RGD1561302
Definition
(RefSeq) family with sequence similarity 167, member A
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: FAM167 LURAP DUF4530 DUF2388
Other DBs
NCBI-GeneID: 498533
NCBI-ProteinID: NP_001102572
RGD: 1561302
Ensembl: ENSRNOG00000011316
UniProt: D3ZQX1
Position
15p12
AA seq 215 aa
MSVPRIQVEEVGEKDRPAGAAIPPDDHLLSLKALTEKLRLETRRPSYLEWQAKLEEQTWP
FPRPAAQQEASLEQGACGGGEPLMSLREPRELLPPARSASGGDRPLATDKLEGFRSIDEA
IAWLRKELAEMRLQDQQLARQLMRLRGDINKMKIEQTCRLHRRMLNDAAFELEERDELSD
LFCDSPLAASFSLSTPLKLIGVTKMNINSRRFSLC
NT seq 648 nt   +upstreamnt  +downstreamnt
atgtctgtgccccggatccaagtggaagaagtgggtgagaaagacaggccagcaggggca
gccatacctcccgacgaccacctcctcagcctgaaggccctcactgagaagctgaggctg
gagacccgaagaccttcctacctggaatggcaagccaagctggaggagcagacctggcct
tttccgaggccagctgcccagcaagaggcgagtctggagcagggagcatgtgggggtgga
gagcctttgatgtctctaagggagcccagagagcttcttccacctgccaggagtgccagt
gggggtgacaggccactggccacagacaagctggaaggcttccggagtatcgacgaagcc
atcgcctggctcagaaaggaactggcagagatgcggctccaggaccagcagctggccagg
cagctcatgcgcctccgaggagacatcaacaaaatgaagatcgagcagacctgccgcctg
cacaggaggatgctcaatgatgctgcctttgagctggaggagcgggacgagctgtccgac
ctcttctgcgactccccgctggcagcctccttcagcctttccaccccgctcaagctcatt
ggcgtcaccaaaatgaacatcaactccagaaggttctctctctgctga

DBGET integrated database retrieval system