KEGG   Rattus norvegicus (rat): 498549Help
Entry
498549            CDS       T01003                                 

Gene name
Akap11, Akap
Definition
(RefSeq) A-kinase anchoring protein 11
  KO
K16527  A-kinase anchor protein 11
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    498549 (Akap11)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     498549 (Akap11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 498549
NCBI-ProteinID: NP_036905
RGD: 2079
Ensembl: ENSRNOG00000009987
UniProt: D3ZS99
Position
15q11
AA seq 1892 aa AA seqDB search
MAAFQPFRNSHTKTKASVRKSFSEDVFQSVKSLLQSEKELCSVSGGECLNQDEHAQLTEI
TFLGFNEETDAAHMKDLAAVSLELPDLLNSLHFCSLSENEIICMKDTNKSSDVSSSPLNQ
SHHSGMLCVMRVSPTLPGLRIDFIFSLLSKYAAGIRHTLDTHLHEKLHLETTDEDDDDTN
QSVSSIEDDFVTAFEQLEEEENAKLCNDEMNIATLRSRCDAASQTTSGHHLESHDLKVLV
SYGSQKSLAKPSPSVNVLGRKEASVKTSVTTSISEPWTQRSLYRSPSASDKGKDTQETFF
PPSPVHSSESECSSPSPVIFLDEEGYQKSLKAKLELPEIPVTKDDIEDSDSEVSEFFDSF
DQFDELEQTLETYLFMEDPVIGKSSQKIGHKYEKSCMNPQKFKFERPALPANVRKPTPRK
PESPYAHLCGAPDSPRPVVASEDSGLFSPIRTSAFSPPGSCPPAECLCQTDTSENRNHEK
YCTYEDYANNLSCEVLGSVLHTQHANTMSDINSIKRGRNNPVTYKHGDSDQKNKCKKSSV
ITDSVQKFAADLVGKSFGSAFKDLQKGVSSCTNALCHLAVKLTSSIFQMAFNELRRQCAF
SLKERAIGSLASLLVSEALSNALKDLQYVKKQMFTNTVARFAADLAEELVFEGIMEVCQF
SCPQTPASSQCQSFDFEDKVVKSYAKDLSESVIQEAFIELSQTDVTFTAKAAVNVSMGSV
KSVNAENAVPPAQTLTFSSSFSSQAVMMTKPMQEHKKEYTVQQALFCTSGIVTSIPVPLA
GSALLPYHVSSTLYQSKSLSSSEHNKANGGSPQEHIAMESSAEEVDCFKNTCLPSELSPC
SQNDFKPTNGDIDMQSPSKLMSGSMIISNFSTAMVHTIVNETLESMTSFKATKPVDTNAD
YLTKTIKGKACSFSLCDQAAPQQNKASSKDMFAEHLSKSIIKHSLDKSKSVLPNIDKKPV
SKEHMLVLGEESQLTLGETPKFLDFSDNSPQYCVPECKDSVGFGFSLEALPPCSMMTSQK
SDLKGVMKDKVVTRHNLTNTALEPLSFGQESSFRPSQTLSSAVLTCVDSLHVEDKQKIRD
RNVIPDTPPSTPLVPSQTSSEWDIKKLTKQLKGELAKEFAPATPPSTPHNSSVGSLSENE
QTTIEKEEFMLKLMRSLSEEVESSEGEEHPEMDVKSEHSGKKGQFADALATHIISLATEV
AASHLDHEITQEFKVQNSHLTVPSQRSMLPALSHLDESIQTCSFASDMAAGVIAEAEKVA
NTRSCMLFGHERTICHVEGDRGKAEEKLDVEDIAHPREVETCVLSLPSCMPGLTYKYPSC
ESVTDEYAGHVIQVLKQEGGNSELIMDQYASRLAYRSVKSGVREAAKTVKVKCSLKLFPM
HTSHVKTNKELLFSSKEHHQEVDKKRQRKKYGSHPCKYQTCDRTQDPCRNELSELYRFSA
SLASSITRDVKKQLTAPKVDLPKSSTDCCLFEKSECVDNRENVTGPEVSKSCQPLQNHGL
CQNTSSLSGYSCGESAHTVEQYARKVVGDTLELSLGPAVFLNSETTTSPDRITYAEKLSP
LINEACRYCDLKESHGCIRNSAQLFSKQGPCASAKPSSHSKLSSIRQKSRIFHLDVPQIH
VNLDKRAVLAEKIVAEAIEKAERELSNTSLAADSGIGQDGISFAESLTTEIMTTAMTNAG
HAVSSSKEVEDFQSTESLGSQQMNLSVGEDSTGSWSNLSFEDDHQDESSSFHHLSESSNG
NSSSWSSLGLEGDLYEDNLSFPTSDSDGPDDRESEQEDGAEGLQPSGKTLLIVNIDVEPG
AVDPQLRVILQWLIASEAEVRELYFQDSAKKEFVLLSKQLQERGWKVGDVLQAVLKYYEV
VAKASSEDTCTSLFDCYLRQALSCAPISFAFW
NT seq 5679 nt NT seq  +upstreamnt  +downstreamnt
atggcggctttccagcctttcagaaatagtcacacgaagactaaagcatctgtccgaaaa
agtttcagtgaagatgtgttccagtccgtaaagtctttattacagagtgagaaggagctg
tgcagtgtatcaggaggagagtgtttaaaccaggatgagcatgcccagttaactgagatc
acatttctgggctttaatgaagaaacagatgctgctcatatgaaggatctagctgcagtt
tcactagaacttccagatcttctgaattcgctccatttctgcagtctaagtgaaaatgaa
atcatttgtatgaaggataccaataaatcttctgatgtaagcagtagtcctctaaatcag
agtcaccattcaggaatgctttgtgtcatgagagtgtcacctacattaccaggactcaga
attgatttcatctttagtctcctaagtaaatatgctgctggcataagacacaccctggac
acacacttgcacgagaagctccaccttgagaccactgatgaagatgacgatgacacgaac
cagtctgtgtcttccatagaggatgactttgtcactgcttttgagcagttggaggaggaa
gagaatgcaaagctgtgtaacgacgaaatgaatattgctacactaaggagccggtgtgat
gctgcctctcagactacttcaggtcaccatttagaaagccatgatcttaaagtgctggtt
agttatggatcacagaagtctttggctaagccctcaccttcagtaaatgttctgggacgc
aaagaagcttctgtgaaaacatcagttacaacatcgatttcagagccctggactcagagg
agtctctacaggtcacccagtgcctcagataaaggcaaggacacacaggagacattcttt
cctccttctcctgtccactcgtcagagtctgagtgctcaagcccaagtcctgtgattttt
ttggatgaagagggatatcaaaaaagtttaaaagcgaaacttgagctgcctgaaatccct
gtgacaaaagatgatatagaggattcagactcagaagtgagtgagttttttgatagcttt
gatcagtttgatgaactagagcaaactttagagacttacctgttcatggaagatcctgtc
atagggaagtcatcacagaagatagggcacaaatatgaaaagtcttgtatgaatcctcag
aaattcaagtttgagcgcccagctcttccagctaatgttagaaagccaacacctcgcaaa
cctgagtctccatatgctcacctgtgtggtgctccagattcccctcgcccagtggtggca
tcagaggacagtggcttgtttagccctattcgaacctctgcttttagtccccctggaagc
tgtcctcctgctgaatgcctttgccaaacagatactagtgaaaataggaatcatgaaaag
tactgcacttacgaagattatgcaaataatctttcatgtgaagtactaggctcagttctt
catactcaacatgcaaacacaatgtcagatattaatagtattaaaaggggaagaaataat
cctgtaacttataagcatggagactctgatcaaaaaaataaatgtaaaaaatcttcagtg
attaccgatagcgttcagaagtttgcagcagatcttgtgggaaaaagttttggcagtgca
tttaaagacttacagaaaggagtttcttcatgtaccaatgcactgtgccacctggctgtc
aaattgacatcatccatatttcagatggcatttaatgaactaagaaggcagtgtgcattt
tcattaaaggagcgagccattggtagcctggccagtcttttggtgagcgaagccttatca
aatgccttgaaagacttacagtatgtgaaaaagcagatgtttacaaacacagttgctagg
tttgctgcagaccttgctgaagagcttgtttttgaaggtatcatggaagtgtgtcagttt
tcatgtcctcagacacctgcatcttcacagtgtcagtcatttgactttgaagacaaagtc
gtgaagtcatatgccaaagatttgtctgaatctgtaatacaagaagcattcatagagctg
tcacagacggacgtgaccttcacagcaaaggcagcagttaatgtttctatgggtagtgtc
aagtccgtgaatgcagaaaatgcagtgccacctgcgcagacccttacattctcctcatcc
tttagcagtcaagcagttatgatgaccaaaccaatgcaggagcataagaaggaatacacg
gtacagcaggctttgttttgtacctcaggaattgtcacttccataccagtgcccttggca
ggtagtgcccttctcccatatcacgtgtcatctactttgtaccagtccaagtctctgtca
tcgtctgagcataataaagcaaatggcggttctccccaagagcacattgccatggaaagc
agtgcagaggaagtggattgttttaaaaacacctgtctaccttcagaactcagtccttgc
agccagaatgacttcaaaccaactaatggtgatatcgacatgcagagtccttcaaaatta
atgagtggctctatgattattagcaacttttccacagcaatggtacatacaatagtaaat
gaaaccttagagtccatgacatccttcaaagccacaaaacctgttgatacaaatgcagat
tatttaactaaaacaataaagggaaaagcctgttctttttccctttgcgaccaagcagca
ccacaacagaacaaagctagcagtaaggacatgtttgctgagcatttatcaaagtctatt
attaaacattccctggataaaagcaagtcagtccttccaaatatagataaaaaaccagtt
agtaaggaacacatgcttgttcttggagaagaatcacagttgaccttgggggaaactccc
aaattccttgacttttcagataattcacctcagtattgtgttccagaatgtaaagattct
gtgggttttggattttctttagaggcactgccaccttgttcaatgatgacaagtcagaaa
tctgacttgaagggagttatgaaggataaagtggtaacaagacacaatctgactaatact
gcgcttgagcccttgtcttttggacaggaaagctctttccgtccctcacagactttatca
tctgcagtgcttacctgtgtagatagtttgcatgtggaagataagcagaaaatcagagac
agaaatgtgatacctgatactcccccatcaacacctttagtaccatcccagactagttct
gaatgggacatcaaaaagttaaccaaacaactcaaaggggagttagccaaagaatttgct
cccgcaacaccaccttcgacacctcacaactcatccgttggtagtttatctgagaatgaa
caaactactatagaaaaggaagagttcatgctgaaactcatgcgctctctttctgaagaa
gttgagagcagtgaaggtgaggagcacccagaaatggatgtaaagtcagagcattcaggg
aaaaaaggtcagtttgcagacgcattagctacacacatcatttctcttgcaactgaagtg
gcagcctcccacttagatcatgaaatcactcaagaattcaaggttcaaaactctcactta
actgtgccaagtcaaagaagcatgctgcctgctctaagtcacttagatgaaagcatacag
acgtgcagttttgcaagtgatatggcagctggtgttattgcagaagccgagaaagttgca
aacactagaagttgtatgcttttcgggcatgagaggaccatttgtcatgttgaaggtgat
cgaggtaaagcagaagagaagctggatgtggaggatattgcacatccaagagaagtagaa
acgtgtgttctttcattaccaagttgcatgccaggtctgacatacaagtatcccagctgt
gaaagtgtgactgatgaatatgctgggcacgttattcaagtgctgaaacaggaaggtggc
aacagtgagctaatcatggatcagtatgccagtagattggcctaccgttctgtcaagtca
ggagtacgagaagcagctaagacagtaaaagtgaagtgcagtttgaaactcttccctatg
cacacctctcatgtgaaaacaaacaaggaactgttgttctcaagtaaagagcatcaccaa
gaagtagataaaaaaagacaaagaaaaaaatatggcagccatccttgcaaataccagaca
tgtgacaggacacaggatccatgtagaaacgaactttctgaactgtacaggttttcagcc
tctcttgctagcagcataacaagagatgtaaagaaacagctgacagcacctaaagttgac
ttgccaaaatcctcaacagactgttgtctttttgaaaaatctgaatgtgttgacaacaga
gagaatgttactggaccagaagtttcaaagtcgtgtcaacctttacaaaaccatggactt
tgccagaacacaagcagtttaagtgggtatagctgtggagagagtgctcacactgtagaa
cagtatgctaggaaagtagtgggtgacactttagagctaagcttaggacctgcagttttc
cttaattcagagaccacaacatcaccagataggattacttatgcagaaaaattgtcacca
cttataaatgaagcttgcagatactgtgaccttaaggaatcccatggttgtatcagaaat
tctgctcagctcttttcaaagcagggtccttgtgctagtgctaagccaagttcacattca
aaacttagtagcatccgccagaaatcaagaatttttcatcttgatgttcctcaaattcat
gttaatcttgataagagggcggtgcttgcagagaagatagtcgctgaagctattgaaaaa
gcagagagagagttgagcaatacgagtttggcagctgatagtggaattggacaagatggc
attagctttgctgagagccttaccacagaaatcatgaccacagctatgacaaatgccggg
catgctgttagcagttcaaaagaagtagaagattttcagtccactgagtcacttggcagc
caacagatgaatcttagtgttggtgaggacagcacgggtagctggtccaacttaagtttt
gaggatgaccatcaagatgaaagcagcagtttccatcatctcagtgaaagcagtaatggt
aacagcagtagctggagcagtcttggtttagaaggagatttgtatgaggacaatttatcc
tttccaacatcagacagtgatggaccggatgatagagagagcgaacaggaggatggtgct
gagggtttgcagccgagtggaaagactctgctgatcgtgaacattgacgtggagcctggg
gcggtggaccctcagctcagggtcattcttcagtggctcattgcctcggaggcggaagtt
agagaactttattttcaggactctgcaaagaaggagtttgtcttactttcaaagcagtta
caggagagaggatggaaagtgggcgatgtcctgcaggctgtgctgaaatactacgaagtg
gtggccaaagcctcaagcgaggacacgtgcacgtcgctgtttgattgttatttgaggcaa
gctctaagttgtgctccgatttcctttgcattctggtga

DBGET integrated database retrieval system