KEGG   Rattus norvegicus (rat): 498587
Entry
498587            CDS       T01003                                 

Gene name
Ldb3
Definition
(RefSeq) LIM domain-binding protein 3 isoform 4
  KO
K19867  PDZ and LIM domain protein 5/6/7
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    498587 (Ldb3)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 LIM domain-containing proteins
  PDZ-LIM family proteins
   498587 (Ldb3)
SSDB
Motif
Pfam: DUF4749 PDZ PDZ_6 PDZ_2 DUF3854
Other DBs
NCBI-GeneID: 498587
NCBI-ProteinID: NP_001103960
RGD: 1564875
Ensembl: ENSRNOG00000059166
Vega: OTTRNOG00000001792
UniProt: Q5XIG1
Position
16
AA seq 283 aa
MSYSVTLTGPGPWGFRLQGGKDFNMPLTISRITPGSKAAQSQLSQGDLVVAIDGVNTDTM
THLEAQNKIKSASYNLSLTLQKSKRPIPISTTAPPIQSPLPVIPHQKVVANSPANADYQE
RFNPSVLKDSALSTHKPIEVKGLGGKATIIHAQYNTPISMYSQDAIMDAIAGQAQAQGSD
FSGSLPVKDLAVDSASPVYQAVIKTQSKPEDEADEWARRSSNLQSRSFRILAQMTGTEYM
QDPDEEALRRSRERFETERNSPRFAKLRNWHHGLSAQILNVKS
NT seq 852 nt   +upstreamnt  +downstreamnt
atgtcttacagtgtgactctgactgggcctgggccctggggcttccgtctgcagggaggc
aaggacttcaatatgcccctcactatctcccggatcaccccaggcagcaaggcggcccag
tcccagctcagtcaaggagatcttgtggtggccattgatggagtcaacacagacaccatg
acccacctggaggcccagaacaagatcaagtcggccagctacaacctgagcctcactctg
cagaagtccaagcgtcctatccccatctccacgacagcaccccctatccagtccccattg
ccagtgatcccccaccaaaaggtggtagccaattctccagccaacgccgactaccaggaa
cgcttcaaccccagtgtcctgaaggactcagccctgtccacccacaagcccattgaggtg
aagggcttgggaggcaaagctaccatcatccacgctcagtacaacaccccaatcagcatg
tactctcaggacgccatcatggacgccatcgctgggcaggcccaggcccagggcagtgac
ttcagtgggagcctccctgtgaaagacctggcggtggacagcgcctctcccgtgtaccag
gctgtgatcaaaacccaaagcaagccagaagatgaggctgatgagtgggcccgccggtcc
tccaacctgcagtctcgttccttccgaatcttggcccagatgaccgggacagaatacatg
caagaccctgatgaggaagctctgcgaaggtcaagggaaaggtttgaaacggaacgtaac
agccctcgttttgccaagttgcgcaactggcaccatggcctttcagcccaaatccttaat
gttaaaagctaa

DBGET integrated database retrieval system