KEGG   Rattus norvegicus (rat): 498587Help
Entry
498587            CDS       T01003                                 

Gene name
Ldb3, RGD1564875
Definition
(RefSeq) LIM domain binding 3
  KO
K19867  LIM domain-binding protein 3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    498587 (Ldb3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4749 PDZ PDZ_6 PDZ_2 DUF3854
Motif
Other DBs
NCBI-GeneID: 498587
NCBI-ProteinID: NP_001103960
RGD: 1564875
Ensembl: ENSRNOG00000059166
Vega: OTTRNOG00000001792
UniProt: Q5XIG1
Position
16p15
AA seq 283 aa AA seqDB search
MSYSVTLTGPGPWGFRLQGGKDFNMPLTISRITPGSKAAQSQLSQGDLVVAIDGVNTDTM
THLEAQNKIKSASYNLSLTLQKSKRPIPISTTAPPIQSPLPVIPHQKVVANSPANADYQE
RFNPSVLKDSALSTHKPIEVKGLGGKATIIHAQYNTPISMYSQDAIMDAIAGQAQAQGSD
FSGSLPVKDLAVDSASPVYQAVIKTQSKPEDEADEWARRSSNLQSRSFRILAQMTGTEYM
QDPDEEALRRSRERFETERNSPRFAKLRNWHHGLSAQILNVKS
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacagtgtgactctgactgggcctgggccctggggcttccgtctgcagggaggc
aaggacttcaatatgcccctcactatctcccggatcaccccaggcagcaaggcggcccag
tcccagctcagtcaaggagatcttgtggtggccattgatggagtcaacacagacaccatg
acccacctggaggcccagaacaagatcaagtcggccagctacaacctgagcctcactctg
cagaagtccaagcgtcctatccccatctccacgacagcaccccctatccagtccccattg
ccagtgatcccccaccaaaaggtggtagccaattctccagccaacgccgactaccaggaa
cgcttcaaccccagtgtcctgaaggactcagccctgtccacccacaagcccattgaggtg
aagggcttgggaggcaaagctaccatcatccacgctcagtacaacaccccaatcagcatg
tactctcaggacgccatcatggacgccatcgctgggcaggcccaggcccagggcagtgac
ttcagtgggagcctccctgtgaaagacctggcggtggacagcgcctctcccgtgtaccag
gctgtgatcaaaacccaaagcaagccagaagatgaggctgatgagtgggcccgccggtcc
tccaacctgcagtctcgttccttccgaatcttggcccagatgaccgggacagaatacatg
caagaccctgatgaggaagctctgcgaaggtcaagggaaaggtttgaaacggaacgtaac
agccctcgttttgccaagttgcgcaactggcaccatggcctttcagcccaaatccttaat
gttaaaagctaa

DBGET integrated database retrieval system