KEGG   Rattus norvegicus (rat): 498658
Entry
498658            CDS       T01003                                 

Gene name
Defa9
Definition
(RefSeq) defensin alpha 9
  KO
K05230  defensin, alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04621  NOD-like receptor signaling pathway
rno05150  Staphylococcus aureus infection
rno05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    498658 (Defa9)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    498658 (Defa9)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    498658 (Defa9)
SSDB
Motif
Pfam: Defensin_propep Defensin_RK-1 MF_alpha_N Defensin_beta_2
Other DBs
NCBI-GeneID: 498658
NCBI-ProteinID: NP_001020934
RGD: 1564555
Ensembl: ENSRNOG00000046453
UniProt: Q4JEI5
Position
16q12.5
AA seq 103 aa
MKTLVLLSALVLLAFQIQADPIQEAEEETKTEEQPADEDQDVSVSFEGPEPSALQNLEIR
WPWKRCHCRSFCRPYENATSFCAQGLFKQHKFCCLETWPPRMK
NT seq 312 nt   +upstreamnt  +downstreamnt
atgaagactcttgtcctcctctctgcccttgtcctgctggcattccagatccaggctgat
cccattcaagaggcagaagaagagactaaaactgaggagcagccagcagatgaggaccag
gatgtgtctgtctcctttgaaggcccagaaccctctgctcttcaaaatttagagatcaga
tggccatggaagaggtgccattgcagaagtttctgcagaccttatgaaaatgccacttcg
ttctgtgctcaaggtctatttaaacaacacaaattctgctgcctagaaacatggccccca
aggatgaaatga

DBGET integrated database retrieval system