KEGG   Rattus norvegicus (rat): 498659
Entry
498659            CDS       T01003                                 

Symbol
RatNP-3b
Name
(RefSeq) neutrophil antibiotic peptide NP-3 precursor
  KO
K05230  defensin, alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04621  NOD-like receptor signaling pathway
rno05150  Staphylococcus aureus infection
rno05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    498659 (RatNP-3b)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    498659 (RatNP-3b)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    498659 (RatNP-3b)
SSDB
Motif
Pfam: Defensin_propep Defensin_1
Other DBs
NCBI-GeneID: 498659
NCBI-ProteinID: NP_001073367
RGD: 1589653
Ensembl: ENSRNOG00000038135
UniProt: Q9Z1F1
Position
16
AA seq 87 aa
MRTLILLTTLLLLALHTQAESPQGSTKEAPDEEQDISVFFGGDKGTALQDAAVKAGVTCS
CRTSSCRFGERLSGACRLNGRIYRLCC
NT seq 264 nt   +upstreamnt  +downstreamnt
atgaggaccctcattctgctcaccacccttctcctgctggccctccacacccaggcagaa
tctccccaaggaagcactaaggaagctccagatgaggagcaggatatttccgtattcttt
ggaggggataaaggcactgctctccaagatgcagctgtgaaggcaggcgtgacctgctct
tgtagaacctcaagctgtcgttttggagaaaggctctctggggcatgtcgtctcaatggc
cgcatctaccgactctgttgctga

DBGET integrated database retrieval system