KEGG   Rattus norvegicus (rat): 498704Help
Entry
498704            CDS       T01003                                 

Gene name
Prr7
Definition
(RefSeq) proline rich 7 (synaptic)
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: WBP-1 HemY_N
Motif
Other DBs
NCBI-GeneID: 498704
NCBI-ProteinID: NP_001102586
RGD: 1561898
Ensembl: ENSRNOG00000021447
UniProt: P0C6T3
Position
17p14
AA seq 269 aa AA seqDB search
MVMSQGTYTFLTCFAGFWLIWGLIVLLCCFCSFLRRRLKRRQEERLREQNLRALELEPLE
LEGSLAGSPPGLAPPPPPHRSRLEAPVHAHSHVHVHPLLHHGPAQPHAHPHPHHHALPHP
PPSHLSVPPRPWSYPRQAESDMSKPPCYEEAVLMAEPPPPYSEVLTDTRGLYRKIVTPFL
SRRDSAEKQEQPPPSYKPLFLDRGYTSALHLPSAPRPAAPCPALCLQADRSRRVFPSWTD
SELSSREPLEHGAWRLPVSIPLFGRTTAV
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggtgatgtcccagggcacctacacgttcctcacgtgcttcgccggcttctggctcatc
tggggtctcatcgtcctgctctgctgcttctgcagcttcctgcgccgccgcctcaaacgg
cgccaggaggagcgactgagggagcagaacctgcgcgccctggagctggagcccctcgag
cttgagggcagcctggctggaagtcctccgggcctggcgccgccaccgccaccgcaccgc
agccgtctggaggcgcctgtgcacgcgcactcgcacgtgcacgtgcaccctctgctgcac
cacgggccggcgcagccgcacgcgcacccgcacccacaccatcacgcactgccgcaccca
ccgccgtcgcacctctccgtgccgccccggccctggagctatccgcgccaagcggaatcg
gacatgtctaagccgccgtgctacgaggaggcggtgctgatggccgagccgccgccgccc
tacagcgaggtgctcacggacactcgcggcctctaccgcaagatcgtcacgccctttctg
agccgccgcgacagcgcggagaagcaggagcagccgcctccgagttacaagcctctcttc
ctggaccggggctatacctcggcgctgcatcttcccagcgccccgcggcccgccgccccc
tgccctgccctctgtctgcaggcggaccgcagccgccgtgtcttccccagctggaccgac
tcagagctcagcagccgagagcccctggagcacggagcttggcgcctgcccgtctccatc
cccttgtttgggaggactacagccgtatag

DBGET integrated database retrieval system