KEGG   Rattus norvegicus (rat): 498791Help
Entry
498791            CDS       T01003                                 

Gene name
Ucn3, RGD1562213
Definition
(RefSeq) urocortin 3
  KO
K05257  urocortin 2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    498791 (Ucn3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CRF
Motif
Other DBs
NCBI-GeneID: 498791
NCBI-ProteinID: NP_001073677
RGD: 1562213
Ensembl: ENSRNOG00000017759
UniProt: A1YKY5
Position
17q12.2
AA seq 164 aa AA seqDB search
MLMPTYFLLLLLLLLGGPRTSLSHKFYNAGPVFSCLNTALSEVKKNKLEDVPVLSKKNFG
YLPTQDPSGEEEDEQKHIKNKRTFSDAVGGNGGRSIRYRYQSQAQPKGKLYPDKVKNDRG
TKFTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQIGKKK
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgctgatgcccacttacttcctgctgcttctgctgctgctcctagggggcccaaggaca
agcctctcccacaagttctacaacgcaggaccagtcttcagctgcctcaacacagccctg
tctgaggtcaagaagaacaagctggaggatgtgccggtgctgagcaagaagaactttggc
tacctgcccacacaagacccttcgggagaagaagaggatgaacaaaaacacatcaagaac
aaaagaactttctcagacgctgtgggtgggaatggaggtagaagcatccggtacagatac
caatcccaagcacagcccaaaggaaagctgtacccggacaaggtcaaaaacgaccggggc
accaagttcactctgtccctcgacgttcccactaacatcatgaacatcctcttcaacatt
gacaaggccaagaatttgcgagccaaggcagcggccaatgctcaactcatggcacagatt
gggaaaaagaaataa

DBGET integrated database retrieval system