KEGG   Rattus norvegicus (rat): 498888
Entry
498888            CDS       T01003                                 

Gene name
Siglec15, RGD1565948
Definition
(RefSeq) sialic acid binding Ig-like lectin 15
  KO
K16352  sialic acid binding Ig-like lectin 15
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:rno04091]
    498888 (Siglec15)
Lectins [BR:rno04091]
 I-type lectins (Siglecs)
  498888 (Siglec15)
SSDB
Motif
Pfam: V-set I-set Ig_3 Ig_2 ig
Other DBs
NCBI-GeneID: 498888
NCBI-ProteinID: NP_001178871
RGD: 1565948
Ensembl: ENSRNOG00000033588
UniProt: D3ZL05
Position
18q12.3
AA seq 341 aa
MEGFLQLLACLACVLQMGSPVKTRRDALGNALNTEELSAPSQRWSMQVPAEVSAEVGDMA
VLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCTAAPGSELCQTALSLHGRFRLLGNP
RRNDLSLRVERLALADSRRYFCRVEFTGDAHDRYESRHGVRLHVTAAPRIVNISVLPGTS
HAFRALCTAEGEPPPTLAWSGPALGNSSAAMQGQGRGYQVTAELPALTRDGRYTCTAANS
LGRAEASVYLFRFHGAPAASTLALLLGALGLKALLLLGLLGARATRRRGDHLAAQDTPPR
SQAQESNYENLSQMNPPGYQLPRVCCEELLNHHHPVIHHEK
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggaggggttcctccaactgctggcctgcttggcctgtgtgctccagatgggatcacct
gtaaaaactcgaagagacgctttgggaaatgctctcaacacagaggagctcagtgcccca
tcgcagcgctggtccatgcaggtgcccgcggaggtgagcgcggaggttggcgacatggcg
gtgctgccctgcaccttcacgcaccctcaccgccactacgacgggccgctgaccgccatc
tggcgcgcgggcgagccgtacgcgggccctcaagtgttccgctgcaccgcggcgccgggc
agcgagctgtgccagacggcgctgagcctgcacggccgcttccgcctgctgggcaacccg
cgccgcaacgacttgtccctgcgcgtcgagcgcctcgccctggcggacagcagacgctac
ttctgccgtgtggagttcaccggcgacgcccacgatcgctatgagagtcgccatggggtc
cggctgcacgtgactgctgcgccccggatcgtcaacatctcagtgctgcctggcacctcg
catgccttccgcgcgctctgcacggccgagggggagccgccgcctaccctagcctggtcc
ggccccgccctgggcaacagctcggctgccatgcaaggccaaggtcgcggctaccaggtg
accgccgaattgcccgcgctgacccgcgatggccgctacacgtgcacggcagccaatagc
cttggtcgcgccgaggccagcgtctacctgttccgcttccacggcgcccccgcagcctcg
accctggcgctcctgctgggcgctctgggcctcaaggcgttgctgctgcttggccttctg
ggtgctcgtgccacacgccgccgaggagatcacctggctgcccaggacacccctccacgg
tctcaggctcaggagtccaattacgaaaatttaagccagatgaatcccccaggctaccag
ctgccacgagtttgctgtgaggaactccttaaccaccatcatccagtcattcaccatgaa
aaataa

DBGET integrated database retrieval system