KEGG   Rattus norvegicus (rat): 498898Help
Entry
498898            CDS       T01003                                 

Gene name
Dok6, RGD1564376
Definition
(RefSeq) docking protein 6
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: IRS PH
Motif
Other DBs
NCBI-GeneID: 498898
NCBI-ProteinID: NP_001178872
RGD: 1564376
Ensembl: ENSRNOG00000038190
UniProt: F1M038
Position
18q13
AA seq 331 aa AA seqDB search
MASNFNDIVKQGYVKIRSRKLGIFRRCWLVFKKASSKGPRRLEKFPDEKAAYFRNFHKVT
ELHNIKNITRLPRETKKHAVAIIFHDETSKTFACESELEAEEWCKHLCMECLGTRLNDIS
LGEPDLLAAGVQREQNERFNVYLMPTPNLDIYGECTMQITHENIYLWDIHNAKVKLVMWP
LSSLRRYGRDSTWFTFESGRMCDTGEGLFTFQTREGEMIYQKVHSATLAIAEQHERLMLE
MEQKARLQTSLTEPMTLSKSISLPRSAYWHHITRQNSVGEIYSLQGHGFGSSKMSRAQTF
PSYAPEQSEEAQPPLSRSSSYGFSYSSSLIQ
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggcctccaactttaacgacatagtcaagcagggatacgtgaaaatccgcagcaggaag
ctcgggatattcagacgatgctggttagtttttaagaaggcttctagcaagggacccaga
aggctagaaaagtttccagatgaaaaggcagcttatttcagaaactttcacaaggtaact
gaactgcacaacatcaaaaatataaccaggctgcctcgagagacaaagaagcatgcagtg
gcaattatctttcatgacgaaacgtcaaagacatttgcttgtgagtcagagctggaggct
gaggaatggtgcaaacatctttgcatggaatgcctggggacaaggctgaatgacatcagc
ctaggggagcctgacctgctggcagctggtgtgcagcgggaacagaatgaacgattcaat
gtttatcttatgcctacacccaaccttgatatttatggtgaatgcacaatgcagatcact
catgagaatatctatctctgggatatccacaatgccaaggtcaagctggtgatgtggcct
cttagctcactgaggagatatggtcgggattcaacttggttcaccttcgagtcaggaaga
atgtgtgacacaggagaaggactattcacttttcaaacaagggaaggagaaatgatctat
cagaaggtccactctgcaacactggctatcgctgagcaacacgaaagactaatgctagaa
atggagcagaaagcccggcttcagacaagcttgactgaaccaatgacgttatcgaaatcc
atctctcttcctcgcagtgcatactggcatcacattacacgtcagaacagcgttggagaa
atctacagcttgcaaggtcatgggtttggttcatcaaagatgtccagggcacagacattt
cccagctatgctccagaacagagtgaagaggctcagccaccgttgtcacggtccagcagc
tatggattcagctatagctccagcctcattcaatga

DBGET integrated database retrieval system