KEGG   Rattus norvegicus (rat): 498922
Entry
498922            CDS       T01003                                 

Gene name
Cbln1
Definition
(RefSeq) cerebellin 1 precursor
  KO
K24235   
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: C1q BclA_C
Other DBs
NCBI-GeneID: 498922
NCBI-ProteinID: NP_001102597
RGD: 1562813
Ensembl: ENSRNOG00000000010
UniProt: P63182
Structure
PDB: 
5KWR 5H48 5H49

Position
19p11
AA seq 193 aa
MLGVVELLLLGAAWLAGPARGQNETEPIVLEGKCLVVCDSNPTSDPTGTALGISVRSGSA
KVAFSAIRSTNHEPSEMSNRTMIIYFDQVLVNIGNNFDSERSTFIAPRKGIYSFNFHVVK
VYNRQTIQVSLMLNGWPVISAFAGDQDVTREAASNGVLIQMEKGDRAYLKLERGNLMGGW
KYSTFSGFLVFPL
NT seq 582 nt   +upstreamnt  +downstreamnt
atgctgggcgtcgtggagctgctgttgttgggggctgcgtggctggcaggcccagcccgc
gggcagaatgagacagaacccatcgtcctggagggcaagtgcctggtggtgtgtgactcc
aaccccacgtccgaccctacgggcactgctctgggcatctctgtgcgctcgggcagcgcc
aaggtggctttctctgccatcaggagcaccaaccatgagccgtccgagatgagtaatcgc
accatgatcatctacttcgaccaggtactagtgaacatcgggaacaactttgactcagaa
cgcagcactttcatcgccccgcgcaaaggcatctacagttttaacttccacgtggtgaaa
gtctacaacagacagaccatccaggtgagcctcatgttgaacggttggccggtgatttca
gccttcgccggcgaccaagacgtgacacgcgaggctgccagcaacggcgtcctcatccag
atggagaaaggcgaccgagcatacctcaagctggagcgggggaacttgatggggggctgg
aagtactcaaccttctctggattcctcgtgtttcccctctga

DBGET integrated database retrieval system