KEGG   Rattus norvegicus (rat): 498943
Entry
498943            CDS       T01003                                 

Definition
(RefSeq) RGD1561415
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: DUF4691
Other DBs
NCBI-GeneID: 498943
NCBI-ProteinID: NP_001102599
RGD: 1561415
Ensembl: ENSRNOG00000017867
UniProt: D3ZAQ5
Position
19q12
AA seq 306 aa
MASAGAKRQPEAQNGAAVGLAQVAEIPECPGTEECLVPAHETCSTPGEDRCPVGHSLEPE
LQEEGINLGEEGLNPGVEAGEERGPKPTSSIVRPAHGPKRKAEAELPPGLLLQKEEPEGS
HSESSLSSKQHKKAKKRKSVGAPVPPAVASASAPTETLGLEPFAVPWVLAGKAQRLRPLY
QYINYCNPELNQAGDGDREPEAEPESELALAPEEAGVEQLQLQTLLPMAGELGLGLALPC
PNPLAPLTHNLPPLVEEVGEEPGGLSSLRVSGSLKAEVDKTTQVDIDKMLSVCAAPLVPP
LSPQYK
NT seq 921 nt   +upstreamnt  +downstreamnt
atggcctcagcaggggccaagaggcagccagaagcccagaatggggcagcagtagggtta
gcccaggttgcagagatccctgagtgtccaggaacagaagagtgtctggtgccagcacac
gagacctgcagcactccaggtgaagacaggtgtccagtaggacacagcttagagccagag
ctccaggaggaaggaataaacctgggagaggaagggctcaatccaggggtggaagcagga
gaggagagaggacccaagcctacatcatccatcgtgaggccagctcatgggcccaagaga
aaggcagaggccgaactgccaccagggctgctgctacagaaggaggagccagaaggcagc
cacagtgaatcctcgctgtcatctaaacagcacaaaaaagccaagaaacgcaagagtgta
ggggctcctgtgcccccagctgtggccagcgcatctgcacccacagagaccttggggctg
gagccctttgctgtgccttgggttcttgcaggaaaagcccagcgcctgcggccactgtac
cagtacatcaactattgcaacccagagctgaatcaggcaggggatggggacagggaaccg
gaggctgagcctgagtcggagttagccctggctcctgaggaggcaggtgtggagcagctg
cagctgcagaccttgctgcccatggcaggtgagctgggcttaggccttgctttgccctgc
cctaatccattagcaccactgacccataatcttcctcctctggtagaggaggttggagag
gagcctgggggtttgtctagtctaagggtgagtggcagcctcaaggctgaggtggataag
acaacccaagtggatattgacaagatgttgagtgtctgtgctgcccctcttgtgcccccg
ctgtcccctcagtacaagtga

DBGET integrated database retrieval system