KEGG   Rattus norvegicus (rat): 499014
Entry
499014            CDS       T01003                                 

Gene name
Zdhhc14, Dhhc14
Definition
(RefSeq) zinc finger, DHHC-type containing 14
  KO
K16675  palmitoyltransferase ZDHHC9/14/18 [EC:2.3.1.225]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     499014 (Zdhhc14)
SSDB
Motif
Pfam: DHHC
Other DBs
NCBI-GeneID: 499014
NCBI-ProteinID: NP_001034432
RGD: 1565877
Ensembl: ENSRNOG00000029049
UniProt: Q2TGJ5
Position
1q11
AA seq 489 aa
MPPGGGGPMKDCEYSQISTHSSSPMESPHKKKKIAARRKWEVFPGRNKFFCNGRIMMARQ
TGVFYLTLILILVTSGLFFAFDCRYLAEKITPAIPVVGGILFFFVMGTLLRTSFSDPGVL
PRATPDEAADLERQIDIANGTSSGGYRPPPRTKEVIINGQTVKLKYCFTCKIFRPPRASH
CSLCDNCVEQFDHHCPWVGNCVGKRNYRFFYMFILSLSFLTVFIFAFVITHVIHRSQQKG
FLDALKDSPASVLEAVICFFSVWSIIGLSGFHTYLISSNQTTNEDIKGSWSNKRGKENYN
PYSYGNIFTNCCVALCGPISPSLIDRRGYIQPDTPQPAAPSNGITMYGATQSQSDMCDQD
QCIQSTKFVLQAAATPLLQSEPSLTSEELHMPGKPGLGTPCASLTLGQPTPPSSMPNLAT
EATLSDIMPLKDEHGGHQFLTPDEAPSPPRMLGAGSPLAHSRTMHMLGLASQDSLHEDSV
RGLVKLSSV
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgcctcccggcggcggcgggcccatgaaagactgcgagtacagtcagatcagcacccac
agctcctcccccatggagtctccccacaagaagaagaaaatcgcagcccggaggaaatgg
gaggtgttcccgggaagaaacaagttcttttgcaacgggaggatcatgatggcccggcag
accggcgttttctacctgacgctcatcctcatcctggtcactagtggactcttcttcgcc
ttcgactgtcggtacctcgcagagaaaatcacccctgccatccccgtggtcggtggcatc
ctgttcttctttgtgatggggactctgcttcggaccagcttcagtgacccgggagttctc
cctcgagccactcctgatgaagcagctgatctggaaaggcaaatagacatcgccaacggc
accagttcagggggctaccgcccgcctcccagaaccaaagaagtcatcatcaatggtcag
actgtgaaactaaagtactgtttcacctgcaagatcttccgcccgcctcgagcctcccac
tgcagcctgtgtgataactgcgtagaacagtttgatcaccactgtccctgggtaggcaac
tgtgtggggaagaggaactacagatttttttatatgtttattttatccctgtcttttctg
acggtctttatctttgcatttgtcatcacgcacgtcatccatcgttcacagcaaaaggga
ttcctcgatgcccttaaggacagtccagcgagtgtgttagaggctgtaatatgcttcttc
tccgtctggtccatcattggcctctcaggtttccacacgtacctgatcagctccaaccag
accacaaatgaagatatcaaaggctcttggtccaataaaagagggaaagaaaattacaac
ccctacagctacggaaacatcttcacgaattgctgtgtcgccctgtgtgggcccatctct
cccagcctaatcgacagaagaggctatatccagcccgacacaccacagccagcagcacca
tcaaatggtatcactatgtatggggccacgcagtcgcagagtgacatgtgcgaccaagac
cagtgcattcagagcaccaaattcgttttgcaggccgcagccactcccctacttcagagc
gagcccagcctcaccagcgaagagctgcatatgcctgggaagccgggtctgggcacccca
tgtgctagcctgacgctgggccagcccacaccaccctcctccatgcccaaccttgccacg
gaggccacactctcagacattatgcccctgaaggatgagcatgggggccaccagtttctg
acgccagacgaggcaccctcaccgccaaggatgctgggagcaggcagccccctggcacac
agccgtaccatgcacatgctggggttggccagccaggactccctgcacgaagactcagtg
aggggcttggtaaagctcagctccgtgtga

DBGET integrated database retrieval system