KEGG   Rattus norvegicus (rat): 499021Help
Entry
499021            CDS       T01003                                 

Gene name
Pacrg, RGD1561027
Definition
(RefSeq) Park2 co-regulated
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: ParcG
Motif
Other DBs
NCBI-GeneID: 499021
NCBI-ProteinID: NP_001071145
RGD: 1561027
UniProt: A0JPP9
Position
1q11
AA seq 302 aa AA seqDB search
MVAEKETLTLNKCPDKMPKRTKLLPQQTIQVHQPHSLVSEGFTVKAMMKNSVVRGPPAAG
AFKERPTKPTAFRKFYERGDFPIALEHDSKGNKIAWKVRGPPAAGAFKERPTKPTAFRKF
YERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLCEMTFPYEFFARQGIHDML
EHGGNKILPVIPQLIIPIKNALNLRNRQVICVTLKVLQHLVVSAEMVGEALVPYYRQILP
ILNIFKNMNVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGEDAFINIKYMVPTYESCL
LN
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggtggcagaaaaagagaccctgaccttaaacaaatgcccagacaagatgccgaagagg
accaaactgctgccacaacagacgatccaggtgcaccagcctcattccctggtttctgag
ggcttcacagtcaaagccatgatgaaaaactcagtcgtgcggggtcctccagccgcaggg
gcatttaaagaaaggccgaccaaacccaccgcattccgaaaattttatgagcgaggagac
ttcccaatcgcccttgagcatgactcgaaaggaaacaaaattgcctggaaggtgcggggt
cctccagccgcaggggcatttaaagaaaggccgaccaaacccaccgcattccgaaaattt
tatgagcgaggagacttcccaatcgcccttgagcatgactcgaaaggaaacaaaattgcc
tggaaggtagagattgagaagctggactaccatcattacctgcctctgttttttgatggg
ctttgtgagatgacgtttccctatgagttttttgctcggcaaggaatccacgacatgctg
gaacatggagggaacaagattctacctgtcattccgcagctcattatcccgataaaaaat
gccttgaacctccgaaacagacaggtcatctgtgtcacgctcaaagttctccagcatctg
gttgtgtccgctgagatggtgggtgaagctttggtgccctactaccgccagatcctgcca
atcctgaacatctttaagaacatgaacgtgaactccggggatggcatcgactacagccag
cagaagagggagaacattggtgacctgatccaggagaccctggaagccttcgagcgctat
ggaggggaggacgccttcatcaacatcaaatacatggtgcccacctatgagtcgtgcttg
ctgaactga

DBGET integrated database retrieval system