KEGG   Rattus norvegicus (rat): 499069Help
Entry
499069            CDS       T01003                                 

Gene name
Nlrp4, Nalp4, Nlrp4e, RGD1563529, RGD1564841
Definition
(RefSeq) NLR family, pyrin domain containing 4
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    499069 (Nlrp4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    499069 (Nlrp4)
Membrane trafficking [BR:rno04131]
 Autophagy
  Other autophagy associated proteins
   Others
    499069 (Nlrp4)
Pattern recognition receptors [BR:rno04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   499069 (Nlrp4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH LRR_6 AAA_16 AAA_30 LRR_1
Motif
Other DBs
NCBI-GeneID: 499069
NCBI-ProteinID: NP_001165635
RGD: 1563529
Ensembl: ENSRNOG00000021996
Position
1q12
AA seq 982 aa AA seqDB search
MASFFSDFGLMWYLEELNKKEFVKFKEFLKQEILQLRLKQISWTKVKKASREDLANLLLK
HYEEKQAWDMTFKIFQKMNRKDLIERAGREIAGHSKLYQAHLKKKLTHDYARKFNIKAQD
LFKQKFTQDDCDRFENLLVSKATGKKPHMVFLQGVAGIGKSLMLTKLMLAWSEGIVFQNK
FSYIFYFCCQDVKQLKRASLAELISREWPNASAPTAEILSQPEKLLFIIDSLEVMECNMS
ERESELCDNCTEKQPVSLLLSSLLRRKMLPESSFLISATPETFEKMEDRIECTNVKIITG
FNENNIKMYFRSLFQDKNRTLEAFSLVRENEQLFNVCQVPVLCWMVATCIKKEIEKGRDP
VFICRRTTSLYTTHIFNLFTPQNAQYPSKKSQDQLQGLCSLAAEGMWTDTFVFSEEALRR
NGILDSDIPTLLDRRILERSKESESCYIFLHPSLQEVCAAVFYLLKSHLDHPSQDVKSVE
ALLFTFLKKAKVQWIFLGCFLFGLLHESEQEKLEMFFGHQLSQEIKHQLYQCLETISVNE
ELQEQIDGMKLFYCLFEMEDEAFLMQAMNCMEQINFVAKDYSDVIVAAYCLKHCSTLKKL
SFSTQNILSEEQEHSYTEKLLICWHHMCSVLISSKDIHVLQVKDTNLNETAFWVLYNHLK
YPSCTLKVLVVNNVTFLCDNHLFFELIQNQRLQHLNLSLTFLSHSDVKLLCDVLNQAECN
IEKLMIAACNLSPDDCKVFASVLISSKMLKHLNLSSNNLDKGISSLCKALCHPDCILKHL
VLANCSLSEQCWDYLSEVVRRNKTLSHLDISSNDLKDEGLKVLCGALTLPDSGLISLSVR
HCLITTSGCQDLAEVLRHNQNLRSLQVSNNKIEDAGVKLLCDAIKQPNCHLENIGLEACE
LTGACCKDLASAFVHCKTLWGINLLENALDHSGLVVLFEALKQQKCTLHVLGLRITDFDK
ETQEFLIAEEEKNPYLSILSNV
NT seq 2949 nt NT seq  +upstreamnt  +downstreamnt
atggcatcattcttttctgattttggccttatgtggtacttggaagagttaaacaagaaa
gaattcgtgaagtttaaggaattcctcaaacaggagattttgcagttgaggctgaaacag
atttcttggaccaaagtgaagaaggcatctcgggaagaccttgccaacttactgttgaaa
cattatgaggagaagcaagcctgggacatgaccttcaaaatcttccagaagatgaacagg
aaggatctcattgagagggcaggaagagagattgctggtcactcaaagttatatcaagct
catttgaagaagaagctgacccatgattatgccagaaagtttaacatcaaagctcaagat
ctctttaagcagaaatttacccaggatgactgtgatcgttttgagaaccttcttgtatca
aaggcaactggaaagaagccacacatggtgttcctacaaggagtggcgggaattggcaag
tcactgatgttgacaaagttaatgctggcctggtcagaaggcatcgtgtttcagaacaaa
ttctcctacatcttctacttctgctgtcaagatgtgaagcagttaaagagagcaagtctg
gcagaactgatctccagagagtggcccaatgcctcggctcccacagcggagatcctctcc
cagccggagaaactcttgtttatcatcgacagcttggaagtgatggaatgcaatatgtcc
gaacgggaatcggagctgtgtgataactgcacggagaagcagcccgtgagtttactgctg
agcagtttgctcaggaggaagatgctccccgaatcctctttcctcatctccgctacccca
gagacttttgagaaaatggaggacaggattgagtgcaccaatgtgaaaataataacagga
ttcaatgagaacaatattaagatgtatttccgcagcttgttccaagataagaacagaacc
ctggaggccttcagtttagtgagagaaaatgagcagctgttcaatgtatgtcaggtccct
gtgctctgctggatggtggctacctgtattaaaaaggagatagagaagggaagagaccca
gtcttcatctgccgacgtaccacctctctgtacaccactcacatcttcaatttgttcact
ccacaaaatgcccagtatccaagtaagaaaagccaagaccagctgcagggcttgtgttct
ctagctgccgagggcatgtggaccgacacatttgtgtttagtgaggaggcgctcaggaga
aatggaatcctggattctgacatccccacattgctggacagacggatccttgaaaggagc
aaggaatctgaaagttgttacattttcctccacccatctctccaggaggtctgtgctgcc
gtcttttatctgctaaagagccacttggaccaccctagccaggacgtaaagagtgtagag
gcactcttgtttacatttctgaagaaagccaaagtacagtggatctttttaggctgtttc
ctctttggccttttacatgaatcggaacaagaaaagctagagatgtttttcggccaccag
ttgtcccaggaaataaagcatcagctgtatcagtgcctggaaaccataagtgtcaatgaa
gagcttcaagaacagatagatggcatgaagttgttttactgtctgtttgagatggaggat
gaagccttcttaatgcaagcaatgaactgtatggagcagattaactttgtggctaaggat
tattctgatgttattgttgctgcctactgcttaaaacactgttctaccctgaagaaacta
tccttttctacccaaaatatcctgagtgaagaacaagaacacagctatacggaaaagcta
ctcatctgttggcatcatatgtgctctgtgcttataagcagtaaggacatccacgtactc
caagtaaaagacactaatctcaatgagacagccttttgggtcttgtataatcatctgaag
taccccagctgcacccttaaagtactcgtggtcaataatgtgaccttcctgtgtgataac
cacctattctttgagttgattcagaaccaacgtttgcagcacctgaacctcagcctcacg
ttcctctcccacagtgatgtgaaactgttgtgtgatgtcttgaaccaggccgagtgcaac
atagaaaagctgatgatagcagcctgtaacctttcccctgatgactgcaaggtctttgcc
tctgtcctgatcagcagcaagatgttgaagcatcttaatttgtcatccaacaacttggac
aaagggatctcctcactgtgcaaggctttgtgccacccagactgcattctgaagcacctg
gtgttagccaactgttccctcagtgagcaatgttgggactatctctcagaagttgttagg
cggaacaaaaccctgagccacctagacatcagctccaatgacctgaaggatgagggactg
aaagttctctgtggagctctgactctcccagacagtggcctgatatcactaagtgtgaga
cattgtctcatcaccactagtggttgccaggacctggctgaagtcttgaggcacaaccag
aacctgaggagcctacaggtttcaaacaataagatcgaagacgctggtgtgaagctgctg
tgtgatgctataaagcaacccaactgccacttagagaatattgggttggaggcctgcgag
ctaactggtgcctgttgtaaggatcttgcttctgcttttgtccactgtaaaaccctgtgg
ggtatcaacctgctagagaacgccttggaccacagtgggttggtcgtgctctttgaggct
ctgaaacagcaaaagtgtaccctgcatgttcttggacttcgaattactgactttgataag
gaaacccaggagttcctgattgcagaggaagagaaaaacccatatttgagcatcctaagc
aatgtataa

DBGET integrated database retrieval system