KEGG   Rattus norvegicus (rat): 499095Help
Entry
499095            CDS       T01003                                 

Gene name
Zfp94
Definition
(RefSeq) zinc finger protein 94
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    499095 (Zfp94)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    499095 (Zfp94)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    499095 (Zfp94)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_jaz Zn-ribbon_8 zf-met zf_UBZ C1_4 zf-C2H2_6
Motif
Other DBs
NCBI-GeneID: 499095
NCBI-ProteinID: NP_001032289
RGD: 1560430
Ensembl: ENSRNOG00000019416
UniProt: Q32P35 F1M973
Position
1q21
AA seq 478 aa AA seqDB search
MVTFRDVAVVFSEEELGLLDAAQRKLYGEVMLENFRMLLSVGGKNLEDTESLEEVGLRHL
PHEELFCSQIWQRVIRELAKARDCRVRVGEHGSPVKRDNRDDEEYSKHSSQKSRLRLHCG
LNGGEEPDREERSEKDSWDSRRQADGRSPVGEKRYRCEKCDLSFCRLSGLQAHQVRHTGE
KPYKCEECGKGFTRASTLLDHQRGHTGNKPYQCGACWKSFCHSSEFNNHIRVHTGEKPYV
CEECGKGFSQASHLLAHQRGHTGEKPYKCSTCGKGFSRSSDLNVHCRIHTGEKPYKCERC
GKAFSRVSILQVHQRVHSEDKPYQCSECGKGFSVESHLQAHQRSHTGERPYQCEECGRGF
CRASNFLAHRGVHTGEKPYQCDVCGKRFRQRSYLHDHHRIHTGEKPYRCEECGKVFSWSS
YLKAHQRVHTGEKPYKCEECGKGFSWSSSLLIHQRVHAEDEGRRDFPASEGSQGKQTL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggtgacctttagggacgtggccgtggtcttcagcgaggaggagctggggctgctggat
gctgcccagaggaagctgtacggagaggtgatgctggagaacttcaggatgctgctctca
gtgggaggcaagaatctagaagacacggagtctctcgaggaggtgggactgaggcacctg
ccacacgaggaacttttctgctcacagatctggcagcgagttataagggagttagccaag
gctcgagattgcagagtacgtgtcggagaacatggctctccggtgaaacgagacaatcgt
gacgacgaggagtacagcaaacattccagtcagaaatcacggctccgactccactgcgga
ctaaatggtggtgaagaacctgacagagaggagaggagtgagaaagactcctgggactct
cgccgtcaggccgatgggcgatcccctgtgggagagaagaggtatagatgtgaaaaatgt
gacctgtccttctgtcggttatcgggtctccaagcccatcaggtgaggcacactggagag
aaaccctacaaatgtgaggagtgtggcaagggcttcactcgggcctccactcttctggac
catcagagaggccacactggaaacaagccctatcagtgtggcgcttgctggaagagtttc
tgtcacagctcggagtttaacaatcacatacgagtccacacgggagagaaaccctatgta
tgtgaggagtgtgggaaaggcttcagccaggcctcccatcttctggcccatcagagaggc
cacacgggagagaaaccctacaaatgtagcacgtgtgggaagggattcagccggagttca
gatcttaacgttcattgtagaatccacacaggagagaaaccctataaatgtgagaggtgt
ggtaaagccttcagtcgagtctcaattctccaagtgcatcagagggtccacagtgaagac
aaaccgtatcagtgctcagagtgtgggaagggcttcagtgtagagtctcaccttcaagcc
caccagaggtcccacactggagagagaccctatcagtgtgaggagtgtgggagaggcttc
tgtcgggcgtccaactttctagctcatcgtggagttcacacaggagagaaaccgtatcaa
tgtgacgtgtgtgggaaacgcttccggcagaggtcctacctccacgaccaccacaggatc
cacacgggagagaaaccgtacagatgcgaggagtgtgggaaagtcttcagttggagctca
tacctcaaagcccaccagagagtccacacgggagagaaaccgtacaagtgtgaggagtgt
gggaaaggcttcagctggagctcaagcctcctgattcaccagcgagtccatgctgaggac
gagggacgcagagatttccctgcgtcagaaggctcacaggggaaacaaactctatga

DBGET integrated database retrieval system