KEGG   Rattus norvegicus (rat): 499280
Entry
499280            CDS       T01003                                 

Gene name
Mapk1ip1, RGD1565431
Definition
(RefSeq) mitogen-activated protein kinase 1 interacting protein 1
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: MISS
Other DBs
NCBI-GeneID: 499280
NCBI-ProteinID: NP_001116254
RGD: 1565431
Ensembl: ENSRNOG00000016935
UniProt: B0JYS4
Position
1q41
AA seq 263 aa
MYPFLPPARLLPGSPAPFLPSGPSCPQPSGPYPGPAVRVPGHTKPYVTTNMPFPELPRPN
SAHTDPAGPLGTQGSMSSGPWAPGMGGQHPNVPYLFPEPSPTPPLPVSGAPPVAWVTVPP
GAWKPPASYPSPEASYPTPGLQPSPNNSYQLPPGPSGASPMPGNLHKVNEMPGGSHSDSS
NPESTLMTTGQKKQLKGDNKAIKRRRYKKKSKRVTWGDIKTLTHKAETLGKQQGHNTTDP
KMMLLCLMTMLHVNSQQEHEGSK
NT seq 792 nt   +upstreamnt  +downstreamnt
atgtatcccttcctccctccggctagactgttaccaggatctccagcaccctttcttcct
tctggaccatcatgtccccaacctagtggtccttatccaggccctgctgtacgagtccct
ggccacacaaagccatatgttacaacaaatatgccctttccagagctacctaggccaaat
agtgcacacacagatccagctggtcctttaggtacacagggatccatgtcttctggacct
tgggcgccaggaatgggagggcagcatcccaatgtgccatatctatttccagagccatct
cccactcctcccctgccagtgtcaggagcaccacctgttgcatgggtcacagtgccacca
ggagcctggaaaccaccggcatcctatccttctcctgaagcttcatatcccaccccagga
ctccagccttctccgaataattcctaccaactgcctccaggaccttctggtgcttcacca
atgcctggtaaccttcataaagtgaatgaaatgccaggtggctcccattctgattcgtcc
aacccggagagcaccttgatgaccactgggcaaaagaagcagctgaagggagacaacaaa
gccatcaagaggagacgttacaagaagaaaagcaagcgagtaacctggggagacatcaag
actctaactcacaaagctgagacattggggaaacaacaaggacacaatactactgacccc
aaaatgatgctgctttgtttaatgactatgctgcatgttaattctcagcaggaacacgaa
gggtccaaatga

DBGET integrated database retrieval system